Recombinant Human ABCC3 protein(871-950 aa), C-His-tagged

Cat.No. : ABCC3-2466H
Product Overview : Recombinant Human ABCC3 protein(O15438)(871-950 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 871-950 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAA
Gene Name ABCC3 ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [ Homo sapiens ]
Official Symbol ABCC3
Synonyms ABCC3; ATP-binding cassette, sub-family C (CFTR/MRP), member 3; canalicular multispecific organic anion transporter 2; cMOAT2; EST90757; MLP2; MOAT D; MRP3; multidrug resistance associated protein; multidrug resistance-associated protein 3; ATP-binding cassette sub-family C member 3; multi-specific organic anion transporter D; canicular multispecific organic anion transporter; ABC31; MOAT-D;
Gene ID 8714
mRNA Refseq NM_001144070
Protein Refseq NP_001137542
MIM 604323
UniProt ID O15438

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCC3 Products

Required fields are marked with *

My Review for All ABCC3 Products

Required fields are marked with *

0
cart-icon