Recombinant Human ABCC3 protein(871-950 aa), C-His-tagged
Cat.No. : | ABCC3-2466H |
Product Overview : | Recombinant Human ABCC3 protein(O15438)(871-950 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 871-950 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAA |
Gene Name | ABCC3 ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [ Homo sapiens ] |
Official Symbol | ABCC3 |
Synonyms | ABCC3; ATP-binding cassette, sub-family C (CFTR/MRP), member 3; canalicular multispecific organic anion transporter 2; cMOAT2; EST90757; MLP2; MOAT D; MRP3; multidrug resistance associated protein; multidrug resistance-associated protein 3; ATP-binding cassette sub-family C member 3; multi-specific organic anion transporter D; canicular multispecific organic anion transporter; ABC31; MOAT-D; |
Gene ID | 8714 |
mRNA Refseq | NM_001144070 |
Protein Refseq | NP_001137542 |
MIM | 604323 |
UniProt ID | O15438 |
◆ Recombinant Proteins | ||
ABCC3-2466H | Recombinant Human ABCC3 protein(871-950 aa), C-His-tagged | +Inquiry |
HRAS-13934H | Recombinant Human HRAS protein, His-tagged | +Inquiry |
ABCC3-60R | Recombinant Rat ABCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCC3-198M | Recombinant Mouse ABCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCC3-5343H | Recombinant Human ABCC3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCC3-9150HCL | Recombinant Human ABCC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC3 Products
Required fields are marked with *
My Review for All ABCC3 Products
Required fields are marked with *