Recombinant Human ABCC4 Protein, GST-Tagged
Cat.No. : | ABCC4-048H |
Product Overview : | Human ABCC4 partial ORF ( AAH41560, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCC4 ATP-binding cassette, sub-family C (CFTR/MRP), member 4 [ Homo sapiens ] |
Official Symbol | ABCC4 |
Synonyms | ABCC4; ATP-binding cassette, sub-family C (CFTR/MRP), member 4; multidrug resistance-associated protein 4; bA464I2.1 (ATP binding cassette; sub family C (CFTR/MRP); member 4); canalicular multispecific organic anion transporter (ABC superfamily); EST170205; MOAT B; MOATB; MRP4; multidrug resistance associated protein 4; multispecific organic anion transporter B; MRP/cMOAT-related ABC transporter; ATP-binding cassette sub-family C member 4; multi-specific organic anion transporter B; bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4); MOAT-B; |
Gene ID | 10257 |
mRNA Refseq | NM_001105515 |
Protein Refseq | NP_001098985 |
MIM | 605250 |
UniProt ID | O15439 |
◆ Recombinant Proteins | ||
ABCC4-1621Z | Recombinant Zebrafish ABCC4 | +Inquiry |
ABCC4-2453H | Recombinant Human ABCC4 protein, His-tagged | +Inquiry |
ABCC4-8119H | Recombinant Human ABCC4 protein, His & T7-tagged | +Inquiry |
ABCC4-048H | Recombinant Human ABCC4 Protein, GST-Tagged | +Inquiry |
PAX2-1539H | Recombinant Human PAX2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC4 Products
Required fields are marked with *
My Review for All ABCC4 Products
Required fields are marked with *
0
Inquiry Basket