Recombinant Human ABCC4 Protein, GST-Tagged

Cat.No. : ABCC4-048H
Product Overview : Human ABCC4 partial ORF ( AAH41560, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014]
Molecular Mass : 37.73 kDa
AA Sequence : MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCC4 ATP-binding cassette, sub-family C (CFTR/MRP), member 4 [ Homo sapiens ]
Official Symbol ABCC4
Synonyms ABCC4; ATP-binding cassette, sub-family C (CFTR/MRP), member 4; multidrug resistance-associated protein 4; bA464I2.1 (ATP binding cassette; sub family C (CFTR/MRP); member 4); canalicular multispecific organic anion transporter (ABC superfamily); EST170205; MOAT B; MOATB; MRP4; multidrug resistance associated protein 4; multispecific organic anion transporter B; MRP/cMOAT-related ABC transporter; ATP-binding cassette sub-family C member 4; multi-specific organic anion transporter B; bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4); MOAT-B;
Gene ID 10257
mRNA Refseq NM_001105515
Protein Refseq NP_001098985
MIM 605250
UniProt ID O15439

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCC4 Products

Required fields are marked with *

My Review for All ABCC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon