Recombinant Human ABCC4 protein, His-tagged
Cat.No. : | ABCC4-2453H |
Product Overview : | Recombinant Human ABCC4 protein(347-707 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 347-707 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TASRVFVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWDKASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRA |
Gene Name | ABCC4 ATP-binding cassette, sub-family C (CFTR/MRP), member 4 [ Homo sapiens ] |
Official Symbol | ABCC4 |
Synonyms | ABCC4; ATP-binding cassette, sub-family C (CFTR/MRP), member 4; multidrug resistance-associated protein 4; bA464I2.1 (ATP binding cassette; sub family C (CFTR/MRP); member 4); canalicular multispecific organic anion transporter (ABC superfamily); EST170205; MOAT B; MOATB; MRP4; multidrug resistance associated protein 4; multispecific organic anion transporter B; MRP/cMOAT-related ABC transporter; ATP-binding cassette sub-family C member 4; multi-specific organic anion transporter B; bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4); MOAT-B; |
Gene ID | 10257 |
mRNA Refseq | NM_001105515 |
Protein Refseq | NP_001098985 |
MIM | 605250 |
UniProt ID | O15439 |
◆ Recombinant Proteins | ||
OLFML3-1453H | Recombinant Human OLFML3 protein, His-tagged | +Inquiry |
ABCC4-048H | Recombinant Human ABCC4 Protein, GST-Tagged | +Inquiry |
ABCC4-2453H | Recombinant Human ABCC4 protein, His-tagged | +Inquiry |
ABCC4-2515C | Recombinant Chicken ABCC4 | +Inquiry |
ABCC4-0104H | Recombinant Human ABCC4 Protein (M1-L1325), eGFP, Strep II, 10×His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC4 Products
Required fields are marked with *
My Review for All ABCC4 Products
Required fields are marked with *