Recombinant Human ABCD1 protein, His-tagged
Cat.No. : | ABCD1-4543H |
Product Overview : | Recombinant Human ABCD1 protein(334-507 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 334-507 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG |
Gene Name | ABCD1 ATP-binding cassette, sub-family D (ALD), member 1 [ Homo sapiens ] |
Official Symbol | ABCD1 |
Synonyms | ABCD1; ATP-binding cassette, sub-family D (ALD), member 1; ALD; ATP-binding cassette sub-family D member 1; adrenoleukodystrophy; ALDP; AMN; adrenoleukodystrophy protein; ABC42; |
Gene ID | 215 |
mRNA Refseq | NM_000033 |
Protein Refseq | NP_000024 |
MIM | 300371 |
UniProt ID | P33897 |
◆ Recombinant Proteins | ||
RFL-21360MF | Recombinant Full Length Mouse Atp-Binding Cassette Sub-Family D Member 1(Abcd1) Protein, His-Tagged | +Inquiry |
RPL23-2383H | Recombinant Human RPL23 protein, His-tagged | +Inquiry |
ABCD1-3738H | Recombinant Human ABCD1, GST-tagged | +Inquiry |
ABCD1-6242Z | Recombinant Zebrafish ABCD1 | +Inquiry |
RFL10946DF | Recombinant Full Length Dictyostelium Discoideum Abc Transporter D Family Member 1(Abcd1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCD1-9149HCL | Recombinant Human ABCD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCD1 Products
Required fields are marked with *
My Review for All ABCD1 Products
Required fields are marked with *
0
Inquiry Basket