Recombinant Human ABCD3 Protein, GST-Tagged
Cat.No. : | ABCD3-055H |
Product Overview : | Human ABCD3 full-length ORF ( AAH09712, 1 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKRYLLNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQVLGKILWH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCD3 ATP-binding cassette, sub-family D (ALD), member 3 [ Homo sapiens ] |
Official Symbol | ABCD3 |
Synonyms | ABCD3; ATP-binding cassette, sub-family D (ALD), member 3; PXMP1; ATP-binding cassette sub-family D member 3; PMP70; ZWS2; 70 kDa peroxisomal membrane protein; Peroxisomal membrane protein-1 (70kD); peroxisomal membrane protein 1 (70kD, Zellweger syndrome); dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)); ABC43; |
Gene ID | 5825 |
mRNA Refseq | NM_001122674 |
Protein Refseq | NP_001116146 |
UniProt ID | P28288 |
◆ Recombinant Proteins | ||
ABCD3-202M | Recombinant Mouse ABCD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCD3-1967C | Recombinant Chicken ABCD3 | +Inquiry |
ABCD3-66R | Recombinant Rat ABCD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36861DF | Recombinant Full Length Dictyostelium Discoideum Abc Transporter D Family Member 3(Abcd3) Protein, His-Tagged | +Inquiry |
ABCD3-056H | Recombinant Human ABCD3 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCD3 Products
Required fields are marked with *
My Review for All ABCD3 Products
Required fields are marked with *