Recombinant Human ABCD3 protein, His-tagged
Cat.No. : | ABCD3-2699H |
Product Overview : | Recombinant Human ABCD3 protein(1-124 aa), fused to His tag, was expressed in E. coli. |
Availability | September 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-124 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ABCD3 ATP-binding cassette, sub-family D (ALD), member 3 [ Homo sapiens ] |
Official Symbol | ABCD3 |
Synonyms | ABCD3; ATP-binding cassette, sub-family D (ALD), member 3; PXMP1; ATP-binding cassette sub-family D member 3; PMP70; ZWS2; 70 kDa peroxisomal membrane protein; Peroxisomal membrane protein-1 (70kD); peroxisomal membrane protein 1 (70kD, Zellweger syndrome); dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)); ABC43; |
Gene ID | 5825 |
mRNA Refseq | NM_001122674 |
Protein Refseq | NP_001116146 |
UniProt ID | P28288 |
◆ Recombinant Proteins | ||
ABCD3-202M | Recombinant Mouse ABCD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-7062RF | Recombinant Full Length Rat Atp-Binding Cassette Sub-Family D Member 3(Abcd3) Protein, His-Tagged | +Inquiry |
Abcd3-3737R | Recombinant Rat Abcd3, His-tagged | +Inquiry |
ABCD3-772HF | Recombinant Full Length Human ABCD3 Protein, GST-tagged | +Inquiry |
ABCD3-66R | Recombinant Rat ABCD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCD3 Products
Required fields are marked with *
My Review for All ABCD3 Products
Required fields are marked with *