Recombinant Human ABCF2 Protein, GST-Tagged
Cat.No. : | ABCF2-061H |
Product Overview : | Human ABCF2 partial ORF ( AAH01661, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ATP-binding casette proteins transport various molecules across extra- and intracellular membranes. Alterations in this gene may be involved in cancer progression. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 7. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCF2 ATP-binding cassette, sub-family F (GCN20), member 2 [ Homo sapiens ] |
Official Symbol | ABCF2 |
Synonyms | ABCF2; ATP-binding cassette, sub-family F (GCN20), member 2; ATP-binding cassette sub-family F member 2; ABC28; EST133090; HUSSY 18; M ABC1; ABC-type transport protein; Iron inhibited ABC transporter 2; iron-inhibited ABC transporter 2; M-ABC1; HUSSY18; HUSSY-18; DKFZp586K1823; |
Gene ID | 10061 |
mRNA Refseq | NM_005692 |
Protein Refseq | NP_005683 |
MIM | 612510 |
UniProt ID | Q9UG63 |
◆ Recombinant Proteins | ||
ABCF2-8137H | Recombinant Human ABCF2 protein, His & T7-tagged | +Inquiry |
ABCF2-5748H | Recombinant Human ABCF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ABCF2-9226H | Recombinant Human ABCF2, GST-tagged | +Inquiry |
ABCF2-0181H | Recombinant Human ABCF2 Protein (Ile396-Val623), N-His-tagged | +Inquiry |
ABCF2-1112M | Recombinant Mouse ABCF2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCF2-9144HCL | Recombinant Human ABCF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCF2 Products
Required fields are marked with *
My Review for All ABCF2 Products
Required fields are marked with *
0
Inquiry Basket