Recombinant Human ABCF2 Protein, GST-Tagged

Cat.No. : ABCF2-061H
Product Overview : Human ABCF2 partial ORF ( AAH01661, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ATP-binding casette proteins transport various molecules across extra- and intracellular membranes. Alterations in this gene may be involved in cancer progression. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 7. [provided by RefSeq, Jul 2013]
Molecular Mass : 37.73 kDa
AA Sequence : MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCF2 ATP-binding cassette, sub-family F (GCN20), member 2 [ Homo sapiens ]
Official Symbol ABCF2
Synonyms ABCF2; ATP-binding cassette, sub-family F (GCN20), member 2; ATP-binding cassette sub-family F member 2; ABC28; EST133090; HUSSY 18; M ABC1; ABC-type transport protein; Iron inhibited ABC transporter 2; iron-inhibited ABC transporter 2; M-ABC1; HUSSY18; HUSSY-18; DKFZp586K1823;
Gene ID 10061
mRNA Refseq NM_005692
Protein Refseq NP_005683
MIM 612510
UniProt ID Q9UG63

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCF2 Products

Required fields are marked with *

My Review for All ABCF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon