Recombinant Human ABCG2 Protein, GST-Tagged
Cat.No. : | ABCG2-066H |
Product Overview : | Human ABCG2 partial ORF ( NP_004818, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MSSSNVEVFIPVSQGNTNGFPATVSNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLING |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCG2 ATP-binding cassette, sub-family G (WHITE), member 2 [ Homo sapiens ] |
Official Symbol | ABCG2 |
Synonyms | ABCG2; ATP-binding cassette, sub-family G (WHITE), member 2; ATP-binding cassette sub-family G member 2; ABCP; BCRP; CD338; EST157481; MXR; ABC transporter; placenta specific MDR protein; breast cancer resistance protein; ATP-binding cassette transporter G2; mitoxantrone resistance-associated protein; placenta-specific ATP-binding cassette transporter; multi drug resistance efflux transport ATP-binding cassette sub-family G (WHITE) member 2; MRX; BMDP; MXR1; ABC15; BCRP1; GOUT1; CDw338; UAQTL1; MGC102821; |
Gene ID | 9429 |
mRNA Refseq | NM_001257386 |
Protein Refseq | NP_001244315 |
MIM | 603756 |
UniProt ID | Q9UNQ0 |
◆ Recombinant Proteins | ||
ABCG2-066H | Recombinant Human ABCG2 Protein, GST-Tagged | +Inquiry |
ABCG2-184R | Recombinant Rhesus monkey ABCG2 Protein, His-tagged | +Inquiry |
ABCG2-5672H | Recombinant Human ABCG2 protein, His-tagged | +Inquiry |
RFL36450RF | Recombinant Full Length Rat Atp-Binding Cassette Sub-Family G Member 2(Abcg2) Protein, His-Tagged | +Inquiry |
ABCG2-065H | Recombinant Human ABCG2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCG2 Products
Required fields are marked with *
My Review for All ABCG2 Products
Required fields are marked with *