Recombinant Human ABCG2 Protein, GST-Tagged

Cat.No. : ABCG2-066H
Product Overview : Human ABCG2 partial ORF ( NP_004818, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]
Molecular Mass : 37.84 kDa
AA Sequence : MSSSNVEVFIPVSQGNTNGFPATVSNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLING
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCG2 ATP-binding cassette, sub-family G (WHITE), member 2 [ Homo sapiens ]
Official Symbol ABCG2
Synonyms ABCG2; ATP-binding cassette, sub-family G (WHITE), member 2; ATP-binding cassette sub-family G member 2; ABCP; BCRP; CD338; EST157481; MXR; ABC transporter; placenta specific MDR protein; breast cancer resistance protein; ATP-binding cassette transporter G2; mitoxantrone resistance-associated protein; placenta-specific ATP-binding cassette transporter; multi drug resistance efflux transport ATP-binding cassette sub-family G (WHITE) member 2; MRX; BMDP; MXR1; ABC15; BCRP1; GOUT1; CDw338; UAQTL1; MGC102821;
Gene ID 9429
mRNA Refseq NM_001257386
Protein Refseq NP_001244315
MIM 603756
UniProt ID Q9UNQ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCG2 Products

Required fields are marked with *

My Review for All ABCG2 Products

Required fields are marked with *

0
cart-icon
0
compare icon