Recombinant Human ABCG8 protein, His-tagged

Cat.No. : ABCG8-2432H
Product Overview : Recombinant Human ABCG8 protein(21-386 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-386 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : SGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLASQVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFSQAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPTSGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCL
Gene Name ABCG8 ATP-binding cassette, sub-family G (WHITE), member 8 [ Homo sapiens ]
Official Symbol ABCG8
Synonyms ABCG8; ATP-binding cassette, sub-family G (WHITE), member 8; ATP binding cassette, sub family G (WHITE), member 8 (sterolin 2); ATP-binding cassette sub-family G member 8; gallbladder disease 4; GBD4; sterolin 2; sterolin-2; ATP-binding cassette, subfamily G, member 8; STSL; MGC142217;
Gene ID 64241
mRNA Refseq NM_022437
Protein Refseq NP_071882
MIM 605460
UniProt ID Q9H221

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCG8 Products

Required fields are marked with *

My Review for All ABCG8 Products

Required fields are marked with *

0
cart-icon