Recombinant Human ABCG8 protein, His-tagged

• Cat.No.: ABCG8-2432H
• Product Overview: Recombinant Human ABCG8 protein(21-386 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-386 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: SGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLASQVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFSQAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPTSGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCL

Gene Information

• Gene Name: ABCG8 ATP-binding cassette, sub-family G (WHITE), member 8 [ Homo sapiens ]
• Official Symbol: ABCG8
• Synonyms: ABCG8; ATP-binding cassette, sub-family G (WHITE), member 8; ATP binding cassette, sub family G (WHITE), member 8 (sterolin 2); ATP-binding cassette sub-family G member 8; gallbladder disease 4; GBD4; sterolin 2; sterolin-2; ATP-binding cassette, subfamily G, member 8; STSL; MGC142217
• Gene ID: 64241
• mRNA Refseq: NM_022437
• Protein Refseq: NP_071882
• MIM: 605460
• UniProt ID: Q9H221