Recombinant Human ABHD2 Protein, C-Myc/DDK-tagged
| Cat.No. : | ABHD2-02H |
| Product Overview : | Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 2 with a C-Myc/DDK tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. |
| Molecular Mass : | 48.1 kDa |
| AA Sequence : | MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Applications : | Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 μg/mL as determined by microplate BCA method |
| Storage Buffer : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Gene Name | ABHD2 abhydrolase domain containing 2, acylglycerol lipase [ Homo sapiens (human) ] |
| Official Symbol | ABHD2 |
| Synonyms | ABHD2; abhydrolase domain containing 2, acylglycerol lipase; HS1-2; LABH2; PHPS1-2; monoacylglycerol lipase ABHD2; 2-arachidonoylglycerol hydrolase; abhydrolase domain-containing protein 2; acetylesterase; alpha/beta hydrolase domain containing protein 2; lung alpha/beta hydrolase 2; progesterone-sensitive lipase; protein PHPS1-2; testicular tissue protein Li 6; EC 3.1.1.23; EC 3.1.1.6; EC 3.1.1.79 |
| Gene ID | 11057 |
| mRNA Refseq | NM_152924 |
| Protein Refseq | NP_690888 |
| MIM | 612196 |
| UniProt ID | P08910 |
| ◆ Recombinant Proteins | ||
| RFL1000BF | Recombinant Full Length Bovine Abhydrolase Domain-Containing Protein 2(Abhd2) Protein, His-Tagged | +Inquiry |
| ABHD2-4893H | Recombinant Human ABHD2 protein, MYC/DDK-tagged | +Inquiry |
| ABHD2-190R | Recombinant Rhesus monkey ABHD2 Protein, His-tagged | +Inquiry |
| ABHD2-1131M | Recombinant Mouse ABHD2 Protein | +Inquiry |
| ABHD2-19R | Recombinant Rhesus Macaque ABHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABHD2-9135HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
| ABHD2-9134HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD2 Products
Required fields are marked with *
My Review for All ABHD2 Products
Required fields are marked with *
