Recombinant Human ABHD2 Protein, His tagged

Cat.No. : ABHD2-3040H
Product Overview : Recombinant Human ABHD2 protein (31-425 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-425 aa
Description : This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein.
Molecular Mass : 46 kDa
AA Sequence : MRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLEHHHHHH
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : 20mM Tris, pH 8.0, 100mM NaCl, 10 % Glycerol, 0.1 % SKL
Concentration : 0.38 mg/mL
Gene Name ABHD2 abhydrolase domain containing 2, acylglycerol lipase [ Homo sapiens (human) ]
Official Symbol ABHD2
Synonyms ABHD2; abhydrolase domain containing 2; abhydrolase domain-containing protein 2; LABH2; protein PHPS1-2; lung alpha/beta hydrolase 2; alpha/beta hydrolase domain containing protein 2; HS1-2; PHPS1-2; MGC26249; MGC111112
Gene ID 11057
mRNA Refseq NM_007011
Protein Refseq NP_008942
MIM 612196
UniProt ID P08910

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABHD2 Products

Required fields are marked with *

My Review for All ABHD2 Products

Required fields are marked with *

0
cart-icon