Recombinant Human ABI1 protein, His-tagged
| Cat.No. : | ABI1-6322H |
| Product Overview : | Recombinant Human ABI1 protein(265-379 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 265-379 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | TIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSP |
| Gene Name | ABI1 abl-interactor 1 [ Homo sapiens ] |
| Official Symbol | ABI1 |
| Synonyms | ABI1; abl-interactor 1; spectrin SH3 domain binding protein 1 , SSH3BP1; abl interactor 1; ABI 1; E3B1; Abelson interactor 1; nap1 binding protein; abl-binding protein 4; interactor protein AblBP4; Abl-interactor protein 1 long; eps8 SH3 domain-binding protein; spectrin SH3 domain-binding protein 1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1; |
| Gene ID | 10006 |
| mRNA Refseq | NM_001012750 |
| Protein Refseq | NP_001012768 |
| MIM | 603050 |
| UniProt ID | Q8IZP0 |
| ◆ Recombinant Proteins | ||
| ABI1-1704H | Recombinant Human ABI1 protein, His & T7-tagged | +Inquiry |
| TUBA1B-38H | Recombinant Human TUBA1B protein, His-tagged | +Inquiry |
| ABI1-6324H | Recombinant Human ABI1 protein, GST-tagged | +Inquiry |
| ABI1-1779H | Recombinant Human ABI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ABI1-085H | Recombinant Human ABI1 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABI1-9128HCL | Recombinant Human ABI1 293 Cell Lysate | +Inquiry |
| ABI1-9129HCL | Recombinant Human ABI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABI1 Products
Required fields are marked with *
My Review for All ABI1 Products
Required fields are marked with *



