Recombinant Human ABI1 protein, His-tagged

Cat.No. : ABI1-6322H
Product Overview : Recombinant Human ABI1 protein(265-379 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 265-379 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : TIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSP
Gene Name ABI1 abl-interactor 1 [ Homo sapiens ]
Official Symbol ABI1
Synonyms ABI1; abl-interactor 1; spectrin SH3 domain binding protein 1 , SSH3BP1; abl interactor 1; ABI 1; E3B1; Abelson interactor 1; nap1 binding protein; abl-binding protein 4; interactor protein AblBP4; Abl-interactor protein 1 long; eps8 SH3 domain-binding protein; spectrin SH3 domain-binding protein 1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1;
Gene ID 10006
mRNA Refseq NM_001012750
Protein Refseq NP_001012768
MIM 603050
UniProt ID Q8IZP0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABI1 Products

Required fields are marked with *

My Review for All ABI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon