Recombinant Human ABLIM1 Protein, GST-Tagged

Cat.No. : ABLIM1-108H
Product Overview : Human ABLIM1 partial ORF ( NP_002304, 637 a.a. - 736 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABLIM1 actin binding LIM protein 1 [ Homo sapiens ]
Official Symbol ABLIM1
Synonyms ABLIM1; actin binding LIM protein 1; ABLIM, LIMAB1; actin-binding LIM protein 1; abLIM; limatin; actin-binding double-zinc-finger protein; actin-binding LIM protein family member 1; ABLIM; LIMAB1; LIMATIN; abLIM-1; MGC1224; FLJ14564; KIAA0059; DKFZp781D0148;
Gene ID 3983
mRNA Refseq NM_001003407
Protein Refseq NP_001003407
MIM 602330
UniProt ID O14639

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABLIM1 Products

Required fields are marked with *

My Review for All ABLIM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon