Recombinant Human ABLIM1 Protein, GST-Tagged

• Cat.No.: ABLIM1-108H
• Product Overview: Human ABLIM1 partial ORF ( NP_002304, 637 a.a. - 736 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABLIM1 actin binding LIM protein 1 [ Homo sapiens ]
• Official Symbol: ABLIM1
• Synonyms: ABLIM1; actin binding LIM protein 1; ABLIM, LIMAB1; actin-binding LIM protein 1; abLIM; limatin; actin-binding double-zinc-finger protein; actin-binding LIM protein family member 1; ABLIM; LIMAB1; LIMATIN; abLIM-1; MGC1224; FLJ14564; KIAA0059; DKFZp781D0148
• Gene ID: 3983
• mRNA Refseq: NM_001003407
• Protein Refseq: NP_001003407
• MIM: 602330
• UniProt ID: O14639