Recombinant Human ABLIM1 Protein, GST-Tagged
| Cat.No. : | ABLIM1-108H |
| Product Overview : | Human ABLIM1 partial ORF ( NP_002304, 637 a.a. - 736 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABLIM1 actin binding LIM protein 1 [ Homo sapiens ] |
| Official Symbol | ABLIM1 |
| Synonyms | ABLIM1; actin binding LIM protein 1; ABLIM, LIMAB1; actin-binding LIM protein 1; abLIM; limatin; actin-binding double-zinc-finger protein; actin-binding LIM protein family member 1; ABLIM; LIMAB1; LIMATIN; abLIM-1; MGC1224; FLJ14564; KIAA0059; DKFZp781D0148; |
| Gene ID | 3983 |
| mRNA Refseq | NM_001003407 |
| Protein Refseq | NP_001003407 |
| MIM | 602330 |
| UniProt ID | O14639 |
| ◆ Recombinant Proteins | ||
| ABLIM1-03HF | Recombinant Full Length Human ABLIM1 Protein | +Inquiry |
| ABLIM1-223M | Recombinant Mouse ABLIM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABLIM1-790HF | Recombinant Full Length Human ABLIM1 Protein, GST-tagged | +Inquiry |
| ABLIM1-3942C | Recombinant Chicken ABLIM1 | +Inquiry |
| ABLIM1-108H | Recombinant Human ABLIM1 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABLIM1-9125HCL | Recombinant Human ABLIM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABLIM1 Products
Required fields are marked with *
My Review for All ABLIM1 Products
Required fields are marked with *
