Recombinant Human ABLIM3 Protein, GST-Tagged
| Cat.No. : | ABLIM3-110H |
| Product Overview : | Human ABLIM3 full-length ORF ( AAH01665.1, 1 a.a. - 544 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the actin-binding LIM (abLIM) family of proteins. These proteins are characterized by an N-terminal LIM domain and a C-terminal dematin-like domain. The encoded protein interacts with actin filaments and may be a component of adherens junctions in several cell types. A variant of this gene may be associated with pain sensitivity in male human patients. [provided by RefSeq, Sep 2016] |
| Molecular Mass : | 88 kDa |
| AA Sequence : | MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLEGNFWKSGCL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABLIM3 actin binding LIM protein family, member 3 [ Homo sapiens ] |
| Official Symbol | ABLIM3 |
| Synonyms | ABLIM3; actin binding LIM protein family, member 3; actin-binding LIM protein 3; KIAA0843; abLIM-3; actin-binding LIM protein family member 3; HMFN1661; |
| Gene ID | 22885 |
| mRNA Refseq | NM_014945 |
| Protein Refseq | NP_055760 |
| MIM | 611305 |
| UniProt ID | O94929 |
| ◆ Recombinant Proteins | ||
| ABLIM3-795HF | Recombinant Full Length Human ABLIM3 Protein, GST-tagged | +Inquiry |
| ABLIM3-110H | Recombinant Human ABLIM3 Protein, GST-Tagged | +Inquiry |
| IL6-1045H | Recombinant Human IL6 protein, His-tagged | +Inquiry |
| ABLIM3-3097H | Recombinant Human ABLIM3, His-tagged | +Inquiry |
| ABLIM3-5094Z | Recombinant Zebrafish ABLIM3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABLIM3-11HCL | Recombinant Human ABLIM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABLIM3 Products
Required fields are marked with *
My Review for All ABLIM3 Products
Required fields are marked with *
