Recombinant Human ABLIM3 Protein, GST-Tagged
Cat.No. : | ABLIM3-110H |
Product Overview : | Human ABLIM3 full-length ORF ( AAH01665.1, 1 a.a. - 544 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the actin-binding LIM (abLIM) family of proteins. These proteins are characterized by an N-terminal LIM domain and a C-terminal dematin-like domain. The encoded protein interacts with actin filaments and may be a component of adherens junctions in several cell types. A variant of this gene may be associated with pain sensitivity in male human patients. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 88 kDa |
AA Sequence : | MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLEGNFWKSGCL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABLIM3 actin binding LIM protein family, member 3 [ Homo sapiens ] |
Official Symbol | ABLIM3 |
Synonyms | ABLIM3; actin binding LIM protein family, member 3; actin-binding LIM protein 3; KIAA0843; abLIM-3; actin-binding LIM protein family member 3; HMFN1661; |
Gene ID | 22885 |
mRNA Refseq | NM_014945 |
Protein Refseq | NP_055760 |
MIM | 611305 |
UniProt ID | O94929 |
◆ Recombinant Proteins | ||
ABLIM3-7322H | Recombinant Human ABLIM3 protein, His-tagged | +Inquiry |
ABLIM3-110H | Recombinant Human ABLIM3 Protein, GST-Tagged | +Inquiry |
IL6-1045H | Recombinant Human IL6 protein, His-tagged | +Inquiry |
ABLIM3-224M | Recombinant Mouse ABLIM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABLIM3-1145M | Recombinant Mouse ABLIM3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABLIM3-11HCL | Recombinant Human ABLIM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABLIM3 Products
Required fields are marked with *
My Review for All ABLIM3 Products
Required fields are marked with *