Recombinant Human ABLIM3 protein, His-tagged

• Cat.No.: ABLIM3-7322H
• Product Overview: Recombinant Human ABLIM3 protein(336-536 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 336-536 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: YYRSGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLEG

Gene Information

• Gene Name: ABLIM3 actin binding LIM protein family, member 3 [ Homo sapiens ]
• Official Symbol: ABLIM3
• Synonyms: ABLIM3; actin binding LIM protein family, member 3; actin-binding LIM protein 3; KIAA0843; abLIM-3; actin-binding LIM protein family member 3; HMFN1661
• Gene ID: 22885
• mRNA Refseq: NM_014945
• Protein Refseq: NP_055760
• MIM: 611305
• UniProt ID: O94929