Recombinant Human ABO Protein, GST-Tagged
Cat.No. : | ABO-111H |
Product Overview : | Human ABO partial ORF ( NP_065202.2, 273 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.76 kDa |
AA Sequence : | SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABO ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) [ Homo sapiens ] |
Official Symbol | ABO |
Synonyms | ABO; ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase); histo-blood group ABO system transferase; A3GALNT; A3GALT1; ABO glycosyltransferase; histo-blood group A transferase; histo-blood group B transferase; histo-blood group A2 transferase; B(A) alpha-1,3-galactosyltransferase; fucosylglycoprotein 3-alpha-galactosyltransferase; fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; glycoprotein-fucosylgalactoside alpha-galactosyltransferase; glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; GTB; NAGAT; |
Gene ID | 28 |
mRNA Refseq | NM_020469 |
Protein Refseq | NP_065202 |
MIM | 110300 |
UniProt ID | P16442 |
◆ Recombinant Proteins | ||
ABO-6661Z | Recombinant Zebrafish ABO | +Inquiry |
ABO-301506H | Recombinant Human ABO protein, GST-tagged | +Inquiry |
ABO-605H | Recombinant Human ABO protein, hFc-tagged | +Inquiry |
RFL-25176MF | Recombinant Full Length Mouse Histo-Blood Group Abo System Transferase(Abo) Protein, His-Tagged | +Inquiry |
ABO-29H | Recombinant Human ABO Protein (AA 65-354), N-6×His/GFP tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABO-9124HCL | Recombinant Human ABO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABO Products
Required fields are marked with *
My Review for All ABO Products
Required fields are marked with *