Recombinant Human ACAA1 Protein (27-331 aa), His-SUMO-tagged
Cat.No. : | ACAA1-302H |
Product Overview : | Recombinant Human ACAA1 Protein (27-331 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 27-331 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 47.9 kDa |
AA Sequence : | LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ] |
Official Symbol | ACAA1 |
Synonyms | ACAA1; beta-ketothiolase; ACAA; THIO; PTHIO; |
Gene ID | 30 |
mRNA Refseq | NM_001130410 |
Protein Refseq | NP_001123882 |
MIM | 604054 |
UniProt ID | P09110 |
◆ Recombinant Proteins | ||
ACAA1-9260H | Recombinant Human ACAA1, GST-tagged | +Inquiry |
ACAA1-408H | Recombinant Human ACAA1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACAA1-424Z | Recombinant Zebrafish ACAA1 | +Inquiry |
ACAA1-1167HFL | Recombinant Full Length Human ACAA1 Protein, C-Flag-tagged | +Inquiry |
ACAA1-870HF | Recombinant Full Length Human ACAA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAA1-9119HCL | Recombinant Human ACAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAA1 Products
Required fields are marked with *
My Review for All ACAA1 Products
Required fields are marked with *