Recombinant Human ACAA1 Protein (27-331 aa), His-SUMO-tagged
| Cat.No. : | ACAA1-302H |
| Product Overview : | Recombinant Human ACAA1 Protein (27-331 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 27-331 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 47.9 kDa |
| AA Sequence : | LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ] |
| Official Symbol | ACAA1 |
| Synonyms | ACAA1; beta-ketothiolase; ACAA; THIO; PTHIO; |
| Gene ID | 30 |
| mRNA Refseq | NM_001130410 |
| Protein Refseq | NP_001123882 |
| MIM | 604054 |
| UniProt ID | P09110 |
| ◆ Recombinant Proteins | ||
| ACAA1-784H | Recombinant Human Acetyl-CoA Acyltransferase 1, His-tagged | +Inquiry |
| ACAA1-3733H | Recombinant Human ACAA1 protein, GST-tagged | +Inquiry |
| ACAA1-122H | Recombinant Human ACAA1 Protein, GST-Tagged | +Inquiry |
| AAMP-1799H | Recombinant Human AAMP protein, GST-tagged | +Inquiry |
| ACAA1-26046TH | Recombinant Human ACAA1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACAA1-9119HCL | Recombinant Human ACAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAA1 Products
Required fields are marked with *
My Review for All ACAA1 Products
Required fields are marked with *
