Recombinant Human ACACA protein, His-tagged
| Cat.No. : | ACACA-9262H |
| Product Overview : | Recombinant Human ACACA protein(2260-2383 aa), fused with His tag, was expressed in E.coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2260-2383 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ACACA acetyl-CoA carboxylase alpha [ Homo sapiens ] |
| Official Symbol | ACACA |
| Synonyms | ACACA; acetyl-CoA carboxylase alpha; ACAC, ACC, acetyl Coenzyme A carboxylase alpha; acetyl-CoA carboxylase 1; ACC1; acetyl CoA carboxylase 1; ACC-alpha; acetyl-Coenzyme A carboxylase alpha; ACC; ACAC; ACCA; ACACAD; |
| Gene ID | 31 |
| mRNA Refseq | NM_198834 |
| Protein Refseq | NP_942131 |
| MIM | 200350 |
| UniProt ID | Q13085 |
| ◆ Recombinant Proteins | ||
| ACACA-435R | Recombinant Rat ACACA Protein | +Inquiry |
| ACACA-375H | Recombinant Human ACACA protein, His/MBP-tagged | +Inquiry |
| ACACA-9262H | Recombinant Human ACACA protein, His-tagged | +Inquiry |
| ACACA-4123H | Recombinant Human ACACA protein, His-tagged | +Inquiry |
| ACACA-26R | Recombinant Rhesus Macaque ACACA Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACACA Products
Required fields are marked with *
My Review for All ACACA Products
Required fields are marked with *
