Recombinant Human ACACA protein, His-tagged
Cat.No. : | ACACA-9262H |
Product Overview : | Recombinant Human ACACA protein(2260-2383 aa), fused with His tag, was expressed in E.coli. |
Availability | September 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2260-2383 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ACACA acetyl-CoA carboxylase alpha [ Homo sapiens ] |
Official Symbol | ACACA |
Synonyms | ACACA; acetyl-CoA carboxylase alpha; ACAC, ACC, acetyl Coenzyme A carboxylase alpha; acetyl-CoA carboxylase 1; ACC1; acetyl CoA carboxylase 1; ACC-alpha; acetyl-Coenzyme A carboxylase alpha; ACC; ACAC; ACCA; ACACAD; |
Gene ID | 31 |
mRNA Refseq | NM_198834 |
Protein Refseq | NP_942131 |
MIM | 200350 |
UniProt ID | Q13085 |
◆ Recombinant Proteins | ||
ACACA-127H | Recombinant Human ACACA protein, GST-tagged | +Inquiry |
ACACA-231M | Recombinant Mouse ACACA Protein, His (Fc)-Avi-tagged | +Inquiry |
ACACA-197R | Recombinant Rhesus monkey ACACA Protein, His-tagged | +Inquiry |
acaca-17Z | Recombinant Zebrafish acaca Protein, His&GST-tagged | +Inquiry |
ACACA-1018M | Recombinant Mouse ACACA Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACACA Products
Required fields are marked with *
My Review for All ACACA Products
Required fields are marked with *