Recombinant Human ACAD11 Protein, GST-tagged

Cat.No. : ACAD11-4239H
Product Overview : Human FLJ12592 partial ORF ( NP_115545, 678 a.a. - 780 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an acyl-CoA dehydrogenase enzyme with a preference for carbon chain lengths between 20 and 26. Naturally occurring read-through transcription occurs between the upstream gene NPHP3 (nephronophthisis 3 (adolescent)) and this gene. [provided by RefSeq, Aug 2015]
Molecular Mass : 37.07 kDa
AA Sequence : RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACAD11 acyl-CoA dehydrogenase family, member 11 [ Homo sapiens ]
Official Symbol ACAD11
Synonyms ACAD11; acyl-CoA dehydrogenase family, member 11; acyl Coenzyme A dehydrogenase family, member 11; acyl-CoA dehydrogenase family member 11; FLJ12592; 62113 protein; acyl-Coenzyme A dehydrogenase family, member 11; ACAD-11; MGC150619;
Gene ID 84129
mRNA Refseq NM_032169
Protein Refseq NP_115545
MIM 614288
UniProt ID Q709F0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACAD11 Products

Required fields are marked with *

My Review for All ACAD11 Products

Required fields are marked with *

0
cart-icon
0
compare icon