Recombinant Human ACBD3 Protein, GST-Tagged
Cat.No. : | ACBD3-147H |
Product Overview : | Human ACBD3 partial ORF ( NP_073572, 73 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACBD3 acyl-CoA binding domain containing 3 [ Homo sapiens ] |
Official Symbol | ACBD3 |
Synonyms | ACBD3; acyl-CoA binding domain containing 3; acyl Coenzyme A binding domain containing 3 , GOCAP1, golgi complex associated protein 1, 60kDa , GOLPH1; Golgi resident protein GCP60; GCP60; PAP7; PBR and PKA associated protein 7; golgi phosphoprotein 1; PKA (RIalpha)-associated protein; PBR- and PKA-associated protein 7; golgi complex associated protein 1, 60kDa; acyl-Coenzyme A binding domain containing 3; peripheral benzodiazepine receptor-associated protein PAP7; GOCAP1; GOLPH1; |
Gene ID | 64746 |
mRNA Refseq | NM_022735 |
Protein Refseq | NP_073572 |
MIM | 606809 |
UniProt ID | Q9H3P7 |
◆ Recombinant Proteins | ||
ACBD3-917HF | Recombinant Full Length Human ACBD3 Protein, GST-tagged | +Inquiry |
Acbd3-1489M | Recombinant Mouse Acbd3 Protein, Myc/DDK-tagged | +Inquiry |
ACBD3-147H | Recombinant Human ACBD3 Protein, GST-Tagged | +Inquiry |
ACBD3-6670H | Recombinant Human ACBD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACBD3-99R | Recombinant Rat ACBD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACBD3-9107HCL | Recombinant Human ACBD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACBD3 Products
Required fields are marked with *
My Review for All ACBD3 Products
Required fields are marked with *