Recombinant Human ACBD4 Protein, GST-Tagged
Cat.No. : | ACBD4-148H |
Product Overview : | Human ACBD4 full-length ORF ( NP_078998.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 61.2 kDa |
AA Sequence : | MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACBD4 acyl-CoA binding domain containing 4 [ Homo sapiens ] |
Official Symbol | ACBD4 |
Synonyms | ACBD4; acyl-CoA binding domain containing 4; acyl Coenzyme A binding domain containing 4; acyl-CoA-binding domain-containing protein 4; FLJ13322; acyl-Coenzyme A binding domain containing 4; HMFT0700; FLJ90623; |
Gene ID | 79777 |
mRNA Refseq | NM_001135704 |
Protein Refseq | NP_001129176 |
UniProt ID | Q8NC06 |
◆ Recombinant Proteins | ||
ACBD4-100R | Recombinant Rat ACBD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACBD4-148H | Recombinant Human ACBD4 Protein, GST-Tagged | +Inquiry |
ACBD4-1064H | Recombinant Human ACBD4 Protein (1-305 aa), His-SUMO-tagged | +Inquiry |
ACBD4-12321Z | Recombinant Zebrafish ACBD4 | +Inquiry |
ACBD4-445R | Recombinant Rat ACBD4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACBD4-9106HCL | Recombinant Human ACBD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACBD4 Products
Required fields are marked with *
My Review for All ACBD4 Products
Required fields are marked with *