Recombinant Human ACBD4 Protein, GST-Tagged

Cat.No. : ACBD4-148H
Product Overview : Human ACBD4 full-length ORF ( NP_078998.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Molecular Mass : 61.2 kDa
AA Sequence : MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACBD4 acyl-CoA binding domain containing 4 [ Homo sapiens ]
Official Symbol ACBD4
Synonyms ACBD4; acyl-CoA binding domain containing 4; acyl Coenzyme A binding domain containing 4; acyl-CoA-binding domain-containing protein 4; FLJ13322; acyl-Coenzyme A binding domain containing 4; HMFT0700; FLJ90623;
Gene ID 79777
mRNA Refseq NM_001135704
Protein Refseq NP_001129176
UniProt ID Q8NC06

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACBD4 Products

Required fields are marked with *

My Review for All ACBD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon