Recombinant Human ACBD7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ACBD7-6168H
• Product Overview: ACBD7 MS Standard C13 and N15-labeled recombinant protein (NP_001034933) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Binds medium- and long-chain acyl-CoA esters.
• Molecular Mass: 9.8 kDa
• AA Sequence: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ACBD7 acyl-CoA binding domain containing 7 [ Homo sapiens (human) ]
• Official Symbol: ACBD7
• Synonyms: ACBD7; acyl-CoA binding domain containing 7; acyl Coenzyme A binding domain containing 7; acyl-CoA-binding domain-containing protein 7; bA455B2.2; FLJ38219; acyl-Coenzyme A binding domain containing 7; FLJ52263; MGC33893
• Gene ID: 414149
• mRNA Refseq: NM_001039844
• Protein Refseq: NP_001034933
• UniProt ID: Q8N6N7