Recombinant Human ACCN5 Protein, GST-Tagged

Cat.No. : ASIC5-153H
Product Overview : Human ACCN5 full-length ORF ( AAI46498.1, 1 a.a. - 505 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. [provided by RefSeq, Jul 2008]
Molecular Mass : 61.2 kDa
AA Sequence : MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASIC5 acid sensing ion channel subunit family member 5 [ Homo sapiens (human) ]
Official Symbol ASIC5
Synonyms ASIC5; acid sensing ion channel subunit family member 5; Acid Sensing Ion Channel Subunit Family Member 5; Amiloride-Sensitive Cation Channel 5, Intestinal; Human Intestine Na(+) Channel; ACCN5; HINAC; Acid-Sensing (Proton-Gated) Ion Channel Family Member 5; Acid Sensing (Proton Gated) Ion Channel Family Member 5; Acid Sensing Ion Channel Family Member 5; Amiloride-Sensitive Cation Channel 5; Amiloride-Sensitive Sodium Channel; Acid-Sensing Ion Channel 5; INAC; acid-sensing ion channel 5; acid sensing (proton gated) ion channel family member 5; acid sensing ion channel family member 5; amiloride-sensitive cation channel 5, intestinal; amiloride-sensitive sodium channel; human intestine Na(+) channel
Gene ID 51802
mRNA Refseq NM_017419
Protein Refseq NP_059115
MIM 616693
UniProt ID Q9NY37

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASIC5 Products

Required fields are marked with *

My Review for All ASIC5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon