Recombinant Human ACCN5 Protein, GST-Tagged
Cat.No. : | ASIC5-153H |
Product Overview : | Human ACCN5 full-length ORF ( AAI46498.1, 1 a.a. - 505 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 61.2 kDa |
AA Sequence : | MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASIC5 acid sensing ion channel subunit family member 5 [ Homo sapiens (human) ] |
Official Symbol | ASIC5 |
Synonyms | ASIC5; acid sensing ion channel subunit family member 5; Acid Sensing Ion Channel Subunit Family Member 5; Amiloride-Sensitive Cation Channel 5, Intestinal; Human Intestine Na(+) Channel; ACCN5; HINAC; Acid-Sensing (Proton-Gated) Ion Channel Family Member 5; Acid Sensing (Proton Gated) Ion Channel Family Member 5; Acid Sensing Ion Channel Family Member 5; Amiloride-Sensitive Cation Channel 5; Amiloride-Sensitive Sodium Channel; Acid-Sensing Ion Channel 5; INAC; acid-sensing ion channel 5; acid sensing (proton gated) ion channel family member 5; acid sensing ion channel family member 5; amiloride-sensitive cation channel 5, intestinal; amiloride-sensitive sodium channel; human intestine Na(+) channel |
Gene ID | 51802 |
mRNA Refseq | NM_017419 |
Protein Refseq | NP_059115 |
MIM | 616693 |
UniProt ID | Q9NY37 |
◆ Recombinant Proteins | ||
ASIC5-2506H | Recombinant Human ASIC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASIC5-153H | Recombinant Human ACCN5 Protein, GST-Tagged | +Inquiry |
ASIC5-1263H | Recombinant Human ASIC5 | +Inquiry |
Asic5-1745M | Recombinant Mouse Asic5 Protein, Myc/DDK-tagged | +Inquiry |
ASIC5-480R | Recombinant Rat ASIC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASIC5 Products
Required fields are marked with *
My Review for All ASIC5 Products
Required fields are marked with *
0
Inquiry Basket