Recombinant Human ACHE protein, His-tagged

• Cat.No.: ACHE-3643H
• Product Overview: Recombinant Human ACHE protein(445-574 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 445-574 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: LAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT

Gene Information

• Gene Name: ACHE acetylcholinesterase [ Homo sapiens ]
• Official Symbol: ACHE
• Synonyms: ACHE; acetylcholinesterase; acetylcholinesterase (YT blood group) , acetylcholinesterase (Yt blood group) , YT; Yt blood group; apoptosis-related acetylcholinesterase; YT; ACEE; ARACHE; N-ACHE
• Gene ID: 43
• mRNA Refseq: NM_000665
• Protein Refseq: NP_000656
• MIM: 100740
• UniProt ID: P22303