Recombinant Human ACHE protein, His-tagged
Cat.No. : | ACHE-3643H |
Product Overview : | Recombinant Human ACHE protein(445-574 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 445-574 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT |
Gene Name | ACHE acetylcholinesterase [ Homo sapiens ] |
Official Symbol | ACHE |
Synonyms | ACHE; acetylcholinesterase; acetylcholinesterase (YT blood group) , acetylcholinesterase (Yt blood group) , YT; Yt blood group; apoptosis-related acetylcholinesterase; YT; ACEE; ARACHE; N-ACHE; |
Gene ID | 43 |
mRNA Refseq | NM_000665 |
Protein Refseq | NP_000656 |
MIM | 100740 |
UniProt ID | P22303 |
◆ Recombinant Proteins | ||
ACHE-36R | Recombinant Rhesus Macaque ACHE Protein, His (Fc)-Avi-tagged | +Inquiry |
ACHE-156H | Recombinant Human ACHE Protein, GST-Tagged | +Inquiry |
ACHE-2415H | Recombinant Human ACHE Protein, His (Fc)-Avi-tagged | +Inquiry |
ACHE-450R | Recombinant Rat ACHE Protein | +Inquiry |
ACHE-130H | Recombinant Human ACHE | +Inquiry |
◆ Native Proteins | ||
ACHE-8345H | Native Human ACHE | +Inquiry |
AchE-09E | Active Native Electric eel Acetylcholinesterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACHE-2163MCL | Recombinant Mouse ACHE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACHE Products
Required fields are marked with *
My Review for All ACHE Products
Required fields are marked with *