Recombinant Human ACIN1 Protein, GST-Tagged

Cat.No. : ACIN1-159H
Product Overview : Human ACIN1 partial ORF ( NP_055792, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Apoptosis is defined by several morphologic nuclear changes, including chromatin condensation and nuclear fragmentation. This gene encodes a nuclear protein that induces apoptotic chromatin condensation after activation by caspase-3, without inducing DNA fragmentation. This protein has also been shown to be a component of a splicing-dependent multiprotein exon junction complex (EJC) that is deposited at splice junctions on mRNAs, as a consequence of pre-mRNA splicing. It may thus be involved in mRNA metabolism associated with splicing. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]
Molecular Mass : 37.84 kDa
AA Sequence : MWRRKHPRTSGGTRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACIN1 apoptotic chromatin condensation inducer 1 [ Homo sapiens ]
Official Symbol ACIN1
Synonyms ACIN1; apoptotic chromatin condensation inducer 1; ACINUS, apoptotic chromatin condensation inducer in the nucleus; apoptotic chromatin condensation inducer in the nucleus; fSAP152; functional spliceosome associated protein 152; KIAA0670; functional spliceosome-associated protein 152; ACN; ACINUS; DKFZp667N107;
Gene ID 22985
mRNA Refseq NM_001164814
Protein Refseq NP_001158286
MIM 604562
UniProt ID Q9UKV3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACIN1 Products

Required fields are marked with *

My Review for All ACIN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon