Recombinant Human ACKR3 Protein (1-40 aa), His-SUMO-tagged
Cat.No. : | ACKR3-1931H |
Product Overview : | Recombinant Human ACKR3 Protein (1-40 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
Description : | Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates. |
Source : | E. coli |
Species : | Human |
Tag : | His-SUMO |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 20.5 kDa |
Protein length : | 1-40 aa |
AA Sequence : | MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name : | ACKR3 atypical chemokine receptor 3 [ Homo sapiens (human) ] |
Official Symbol : | ACKR3 |
Synonyms : | RDC1; CXCR7; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159; |
Gene ID : | 57007 |
mRNA Refseq : | NM_020311 |
Protein Refseq : | NP_064707 |
UniProt ID : | P25106 |
Products Types
◆ Recombinant Protein | ||
ACKR3-2171H | Recombinant Human ACKR3 Protein (Leu273-Lys362), N-His tagged | +Inquiry |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket