Recombinant Human ACOT9 protein, His-tagged
Cat.No. : | ACOT9-3818H |
Product Overview : | Recombinant Human ACOT9 protein(1-212 aa), fused to His tag, was expressed in E. coli. |
Availability | August 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-212 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ACOT9 acyl-CoA thioesterase 9 [ Homo sapiens ] |
Official Symbol | ACOT9 |
Synonyms | ACOT9; acyl-CoA thioesterase 9; acyl-coenzyme A thioesterase 9, mitochondrial; ACATE2; CGI 16; MT ACT48; acyl-CoA thioester hydrolase 9; mitochondrial Acyl-CoA Thioesterase; acyl-Coenzyme A thioesterase 2, mitochondrial; CGI-16; MTACT48; MT-ACT48; |
Gene ID | 23597 |
mRNA Refseq | NM_001033583 |
Protein Refseq | NP_001028755 |
MIM | 300862 |
UniProt ID | Q9Y305 |
◆ Recombinant Proteins | ||
ACOT9-1207M | Recombinant Mouse ACOT9 Protein | +Inquiry |
ACOT9-9302H | Recombinant Human ACOT9, GST-tagged | +Inquiry |
ACOT9-3818H | Recombinant Human ACOT9 protein, His-tagged | +Inquiry |
Acot9-1501M | Recombinant Mouse Acot9 Protein, Myc/DDK-tagged | +Inquiry |
ACOT9-260M | Recombinant Mouse ACOT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACOT9-15HCL | Recombinant Human ACOT9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACOT9 Products
Required fields are marked with *
My Review for All ACOT9 Products
Required fields are marked with *