Recombinant Human ACOT9 protein, His-tagged
| Cat.No. : | ACOT9-3818H |
| Product Overview : | Recombinant Human ACOT9 protein(1-212 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-212 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ACOT9 acyl-CoA thioesterase 9 [ Homo sapiens ] |
| Official Symbol | ACOT9 |
| Synonyms | ACOT9; acyl-CoA thioesterase 9; acyl-coenzyme A thioesterase 9, mitochondrial; ACATE2; CGI 16; MT ACT48; acyl-CoA thioester hydrolase 9; mitochondrial Acyl-CoA Thioesterase; acyl-Coenzyme A thioesterase 2, mitochondrial; CGI-16; MTACT48; MT-ACT48; |
| Gene ID | 23597 |
| mRNA Refseq | NM_001033583 |
| Protein Refseq | NP_001028755 |
| MIM | 300862 |
| UniProt ID | Q9Y305 |
| ◆ Recombinant Proteins | ||
| ACOT9-5404H | Recombinant Human ACOT9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ACOT9-260M | Recombinant Mouse ACOT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACOT9-915HF | Recombinant Full Length Human ACOT9 Protein, GST-tagged | +Inquiry |
| ACOT9-1207M | Recombinant Mouse ACOT9 Protein | +Inquiry |
| ACOT9-2049C | Recombinant Chicken ACOT9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACOT9-15HCL | Recombinant Human ACOT9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACOT9 Products
Required fields are marked with *
My Review for All ACOT9 Products
Required fields are marked with *
