Recombinant Human ACOX2 Protein, GST-Tagged
Cat.No. : | ACOX2-174H |
Product Overview : | Human ACOX2 partial ORF ( NP_003491, 582 a.a. - 681 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe mental retardation, and death in children. [provided by RefSeq, Mar 2009] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACOX2 acyl-CoA oxidase 2, branched chain [ Homo sapiens ] |
Official Symbol | ACOX2 |
Synonyms | ACOX2; acyl-CoA oxidase 2, branched chain; acyl Coenzyme A oxidase 2, branched chain; peroxisomal acyl-coenzyme A oxidase 2; BRCACOX; BRCOX; THCA-CoA oxidase; trihydroxycoprostanoyl-CoA oxidase; acyl-Coenzyme A oxidase 2, branched chain; peroxisomal branched chain acyl-CoA oxidase; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase; BCOX; THCCox; |
Gene ID | 8309 |
mRNA Refseq | NM_003500 |
Protein Refseq | NP_003491 |
MIM | 601641 |
UniProt ID | Q99424 |
◆ Recombinant Proteins | ||
ACOX2-173H | Recombinant Human ACOX2 Protein, GST-Tagged | +Inquiry |
ACOX2-174H | Recombinant Human ACOX2 Protein, GST-Tagged | +Inquiry |
ACOX2-262M | Recombinant Mouse ACOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACOX2-798HF | Recombinant Full Length Human ACOX2 Protein, GST-tagged | +Inquiry |
ACOX2-43H | Recombinant Human ACOX2 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACOX2-9085HCL | Recombinant Human ACOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACOX2 Products
Required fields are marked with *
My Review for All ACOX2 Products
Required fields are marked with *
0
Inquiry Basket