Recombinant Human ACOX2 Protein, GST-Tagged

Cat.No. : ACOX2-174H
Product Overview : Human ACOX2 partial ORF ( NP_003491, 582 a.a. - 681 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe mental retardation, and death in children. [provided by RefSeq, Mar 2009]
Molecular Mass : 36.74 kDa
AA Sequence : HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACOX2 acyl-CoA oxidase 2, branched chain [ Homo sapiens ]
Official Symbol ACOX2
Synonyms ACOX2; acyl-CoA oxidase 2, branched chain; acyl Coenzyme A oxidase 2, branched chain; peroxisomal acyl-coenzyme A oxidase 2; BRCACOX; BRCOX; THCA-CoA oxidase; trihydroxycoprostanoyl-CoA oxidase; acyl-Coenzyme A oxidase 2, branched chain; peroxisomal branched chain acyl-CoA oxidase; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase; BCOX; THCCox;
Gene ID 8309
mRNA Refseq NM_003500
Protein Refseq NP_003491
MIM 601641
UniProt ID Q99424

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACOX2 Products

Required fields are marked with *

My Review for All ACOX2 Products

Required fields are marked with *

0
cart-icon