Recombinant Human ACP1 protein, His-tagged
Cat.No. : | ACP1-5711H |
Product Overview : | Recombinant Human ACP1 protein(15-102 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 15-102 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNR |
Gene Name | ACP1 acid phosphatase 1, soluble [ Homo sapiens ] |
Official Symbol | ACP1 |
Synonyms | ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; adipocyte acid phosphatase; red cell acid phosphatase 1; protein tyrosine phosphatase; acid phosphatase of erythrocyte; cytoplasmic phosphotyrosyl protein phosphatase; low molecular weight cytosolic acid phosphatase; HAAP; MGC3499; MGC111030; |
Gene ID | 52 |
mRNA Refseq | NM_001040649 |
Protein Refseq | NP_001035739 |
MIM | 171500 |
UniProt ID | P24666 |
◆ Recombinant Proteins | ||
ACP1-5711H | Recombinant Human ACP1 protein, His-tagged | +Inquiry |
AKAP8-3032H | Recombinant Human AKAP8, His-tagged | +Inquiry |
AKAP8-633H | Recombinant Human AKAP8 protein, His&Myc-tagged | +Inquiry |
AKAP8-403H | Recombinant Human AKAP8 Protein, GST-tagged | +Inquiry |
AKAP8-1354HF | Recombinant Full Length Human AKAP8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP8-46HCL | Recombinant Human AKAP8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKAP8 Products
Required fields are marked with *
My Review for All AKAP8 Products
Required fields are marked with *
0
Inquiry Basket