Recombinant Human ACRC Protein, GST-Tagged
| Cat.No. : | ACRC-189H |
| Product Overview : | Human ACRC partial ORF ( NP_443189.1, 592 a.a. - 691 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GCNA (Germ Cell Nuclear Acidic Peptidase) is a Protein Coding gene. Diseases associated with GCNA include Appendix Adenocarcinoma. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | HEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACRC acidic repeat containing [ Homo sapiens ] |
| Official Symbol | ACRC |
| Synonyms | ACRC; acidic repeat containing; acidic repeat-containing protein; putative nuclear protein; NAAR1; |
| Gene ID | 93953 |
| mRNA Refseq | NM_052957 |
| Protein Refseq | NP_443189 |
| MIM | 300369 |
| UniProt ID | Q96QF7 |
| ◆ Recombinant Proteins | ||
| ACRC-189H | Recombinant Human ACRC Protein, GST-Tagged | +Inquiry |
| ACRC-813HF | Recombinant Full Length Human ACRC Protein, GST-tagged | +Inquiry |
| ACRC-188H | Recombinant Human ACRC Protein, GST-Tagged | +Inquiry |
| ACRC-2225Z | Recombinant Zebrafish ACRC | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACRC-17HCL | Recombinant Human ACRC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACRC Products
Required fields are marked with *
My Review for All ACRC Products
Required fields are marked with *
