Recombinant Human ACRC Protein, GST-Tagged
Cat.No. : | ACRC-189H |
Product Overview : | Human ACRC partial ORF ( NP_443189.1, 592 a.a. - 691 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GCNA (Germ Cell Nuclear Acidic Peptidase) is a Protein Coding gene. Diseases associated with GCNA include Appendix Adenocarcinoma. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | HEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACRC acidic repeat containing [ Homo sapiens ] |
Official Symbol | ACRC |
Synonyms | ACRC; acidic repeat containing; acidic repeat-containing protein; putative nuclear protein; NAAR1; |
Gene ID | 93953 |
mRNA Refseq | NM_052957 |
Protein Refseq | NP_443189 |
MIM | 300369 |
UniProt ID | Q96QF7 |
◆ Recombinant Proteins | ||
ACRC-189H | Recombinant Human ACRC Protein, GST-Tagged | +Inquiry |
ACRC-188H | Recombinant Human ACRC Protein, GST-Tagged | +Inquiry |
ACRC-813HF | Recombinant Full Length Human ACRC Protein, GST-tagged | +Inquiry |
ACRC-2225Z | Recombinant Zebrafish ACRC | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACRC-17HCL | Recombinant Human ACRC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACRC Products
Required fields are marked with *
My Review for All ACRC Products
Required fields are marked with *