Recombinant Human ACSL3 protein, His-tagged
| Cat.No. : | ACSL3-15H | 
| Product Overview : | Recombinant Human ACSL3 protein(O95573)(42-720 aa), fused with C-terminal His tag, was expressed in HEK293. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | His | 
| Protein Length : | 42-720 aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 76.9 kDa | 
| AASequence : | YFFSESRQEKSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| Gene Name | ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ] | 
| Official Symbol | ACSL3 | 
| Synonyms | ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194; LACS 3; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 3; fatty-acid-Coenzyme A ligase, long-chain 3; FACL3; | 
| Gene ID | 2181 | 
| mRNA Refseq | NM_004457 | 
| Protein Refseq | NP_004448 | 
| MIM | 602371 | 
| UniProt ID | O95573 | 
| ◆ Recombinant Proteins | ||
| ACSL3-3786H | Recombinant Human ACSL3 protein, GST-tagged | +Inquiry | 
| ACSL3-3787H | Recombinant Human ACSL3 protein, His-tagged | +Inquiry | 
| ACSL3-789HF | Recombinant Full Length Human ACSL3 Protein, GST-tagged | +Inquiry | 
| ACSL3-796H | Recombinant Human ACSL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ACSL3-470R | Recombinant Rat ACSL3 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry | 
| ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ACSL3 Products
Required fields are marked with *
My Review for All ACSL3 Products
Required fields are marked with *
  
        
    
      
            