Recombinant Human ACSL3 protein, His-tagged
Cat.No. : | ACSL3-15H |
Product Overview : | Recombinant Human ACSL3 protein(O95573)(42-720 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 42-720 aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 76.9 kDa |
AASequence : | YFFSESRQEKSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ] |
Official Symbol | ACSL3 |
Synonyms | ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194; LACS 3; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 3; fatty-acid-Coenzyme A ligase, long-chain 3; FACL3; |
Gene ID | 2181 |
mRNA Refseq | NM_004457 |
Protein Refseq | NP_004448 |
MIM | 602371 |
UniProt ID | O95573 |
◆ Recombinant Proteins | ||
ACSL3-197H | Recombinant Human ACSL3 Protein, GST-tagged | +Inquiry |
ACSL3-1483H | Recombinant Human ACSL3 Protein, Myc/DDK-tagged | +Inquiry |
ACSL3-470R | Recombinant Rat ACSL3 Protein | +Inquiry |
ACSL3-1459HFL | Recombinant Full Length Human ACSL3 Protein, C-Flag-tagged | +Inquiry |
ACSL3-3786H | Recombinant Human ACSL3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSL3 Products
Required fields are marked with *
My Review for All ACSL3 Products
Required fields are marked with *