Recombinant Human ACSM1 Protein, GST-tagged

Cat.No. : ACSM1-204H
Product Overview : Human ACSM1 partial ORF ( NP_443188.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ACSM1 (Acyl-CoA Synthetase Medium-Chain Family Member 1) is a Protein Coding gene. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include GTP binding and fatty acid ligase activity. An important paralog of this gene is ACSM4.
Molecular Mass : 37.84 kDa
AA Sequence : MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFNFASYVLDYWAQKEKEGKRGPNPAFWWVNGQGDEVKWSFREMGDLTRRVANVFTQTCGLQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACSM1 acyl-CoA synthetase medium-chain family member 1 [ Homo sapiens ]
Official Symbol ACSM1
Synonyms BUCS1; MACS1
Gene ID 116285
mRNA Refseq NM_052956.2
Protein Refseq NP_443188.2
MIM 614357
UniProt ID Q08AH1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACSM1 Products

Required fields are marked with *

My Review for All ACSM1 Products

Required fields are marked with *

0
cart-icon