Recombinant Human ACSS2 Protein, GST-tagged

Cat.No. : ACSS2-210H
Product Overview : Human ACSS2 partial ORF ( NP_061147.1, 32 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]
Molecular Mass : 36.63 kDa
AA Sequence : PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACSS2 acyl-CoA synthetase short-chain family member 2 [ Homo sapiens ]
Official Symbol ACSS2
Synonyms ACSS2; acyl-CoA synthetase short-chain family member 2; ACAS2, acetyl Coenzyme A synthetase 2 (ADP forming); acetyl-coenzyme A synthetase, cytoplasmic; AceCS; ACS; ACSA; dJ1161H23.1; acetate thiokinase; acetate-CoA ligase; acyl-activating enzyme; cytoplasmic acetyl-coenzyme A synthetase; acetyl-Coenzyme A synthetase 2 (ADP forming); ACAS2; ACECS; DKFZp762G026;
Gene ID 55902
mRNA Refseq NM_001076552
Protein Refseq NP_001070020
MIM 605832
UniProt ID Q9NR19

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACSS2 Products

Required fields are marked with *

My Review for All ACSS2 Products

Required fields are marked with *

0
cart-icon