Recombinant Human ACSS2 Protein, GST-tagged
Cat.No. : | ACSS2-210H |
Product Overview : | Human ACSS2 partial ORF ( NP_061147.1, 32 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACSS2 acyl-CoA synthetase short-chain family member 2 [ Homo sapiens ] |
Official Symbol | ACSS2 |
Synonyms | ACSS2; acyl-CoA synthetase short-chain family member 2; ACAS2, acetyl Coenzyme A synthetase 2 (ADP forming); acetyl-coenzyme A synthetase, cytoplasmic; AceCS; ACS; ACSA; dJ1161H23.1; acetate thiokinase; acetate-CoA ligase; acyl-activating enzyme; cytoplasmic acetyl-coenzyme A synthetase; acetyl-Coenzyme A synthetase 2 (ADP forming); ACAS2; ACECS; DKFZp762G026; |
Gene ID | 55902 |
mRNA Refseq | NM_001076552 |
Protein Refseq | NP_001070020 |
MIM | 605832 |
UniProt ID | Q9NR19 |
◆ Recombinant Proteins | ||
ACSS2-4019H | Recombinant Human ACSS2 protein, His-tagged | +Inquiry |
Acss2-1513M | Recombinant Mouse Acss2 Protein, Myc/DDK-tagged | +Inquiry |
ACSS2-67H | Recombinant Human ACSS2 Protein, His-tagged | +Inquiry |
ACSS2-4280H | Recombinant Human ACSS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACSS2-1236M | Recombinant Mouse ACSS2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSS2-9068HCL | Recombinant Human ACSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSS2 Products
Required fields are marked with *
My Review for All ACSS2 Products
Required fields are marked with *
0
Inquiry Basket