Recombinant Human ACSS2 Protein, GST-tagged
| Cat.No. : | ACSS2-210H |
| Product Overview : | Human ACSS2 partial ORF ( NP_061147.1, 32 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACSS2 acyl-CoA synthetase short-chain family member 2 [ Homo sapiens ] |
| Official Symbol | ACSS2 |
| Synonyms | ACSS2; acyl-CoA synthetase short-chain family member 2; ACAS2, acetyl Coenzyme A synthetase 2 (ADP forming); acetyl-coenzyme A synthetase, cytoplasmic; AceCS; ACS; ACSA; dJ1161H23.1; acetate thiokinase; acetate-CoA ligase; acyl-activating enzyme; cytoplasmic acetyl-coenzyme A synthetase; acetyl-Coenzyme A synthetase 2 (ADP forming); ACAS2; ACECS; DKFZp762G026; |
| Gene ID | 55902 |
| mRNA Refseq | NM_001076552 |
| Protein Refseq | NP_001070020 |
| MIM | 605832 |
| UniProt ID | Q9NR19 |
| ◆ Recombinant Proteins | ||
| ACSS2-0281H | Recombinant Human ACSS2 Protein (G2-Q701), His tagged | +Inquiry |
| ACSS2-1236M | Recombinant Mouse ACSS2 Protein | +Inquiry |
| ACSS2-752Z | Recombinant Zebrafish ACSS2 | +Inquiry |
| Acss2-68M | Recombinant Mouse Acss2 Protein, His-tagged | +Inquiry |
| ACSS2-4019H | Recombinant Human ACSS2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACSS2-473HKCL | Human ACSS2 Knockdown Cell Lysate | +Inquiry |
| ACSS2-9068HCL | Recombinant Human ACSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSS2 Products
Required fields are marked with *
My Review for All ACSS2 Products
Required fields are marked with *



