Recombinant Human ACTG1 protein(41-290 aa), C-His-tagged
| Cat.No. : | ACTG1-2806H |
| Product Overview : | Recombinant Human ACTG1 protein(P63261)(41-290 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 41-290 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIR |
| Gene Name | ACTG1 actin, gamma 1 [ Homo sapiens ] |
| Official Symbol | ACTG1 |
| Synonyms | ACTG1; actin, gamma 1; ACTG, deafness, autosomal dominant 20; deafness, autosomal dominant 26 , DFNA20, DFNA26; actin, cytoplasmic 2; cytoskeletal gamma-actin; ACT; ACTG; DFNA20; DFNA26; |
| Gene ID | 71 |
| mRNA Refseq | NM_001199954 |
| Protein Refseq | NP_001186883 |
| MIM | 102560 |
| UniProt ID | P63261 |
| ◆ Recombinant Proteins | ||
| ACTg1-3087H | Recombinant Human ACTg1, His-tagged, GST-tagged | +Inquiry |
| ACTG1-0366H | Recombinant Human ACTG1 Protein (Met1-Phe375), His-tagged | +Inquiry |
| Actg1-3094M | Recombinant Mouse Actg1, His-tagged | +Inquiry |
| ACTG1-819HF | Recombinant Full Length Human ACTG1 Protein, GST-tagged | +Inquiry |
| ACTG1-2806H | Recombinant Human ACTG1 protein(41-290 aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACTG1-9064HCL | Recombinant Human ACTG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTG1 Products
Required fields are marked with *
My Review for All ACTG1 Products
Required fields are marked with *



