Recombinant Human ACTG1 protein, T7-tagged

• Cat.No.: ACTG1-162H
• Product Overview: Recombinant human ACTG1 (357 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 357 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFGSEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNKANREKMTQIMFETFNTPAMYVA IQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR DIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKC DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: ACTG1 actin, gamma 1 [ Homo sapiens ]
• Official Symbol: ACTG1
• Synonyms: ACTG1; actin, gamma 1; ACTG, deafness, autosomal dominant 20; deafness, autosomal dominant 26 , DFNA20, DFNA26; actin, cytoplasmic 2; cytoskeletal gamma-actin; ACT; ACTG; DFNA20; DFNA26
• Gene ID: 71
• mRNA Refseq: NM_001199954
• Protein Refseq: NP_001186883
• MIM: 102560
• UniProt ID: P63261
• Chromosome Location: 17q25
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem
• Function: ATP binding; identical protein binding; nucleotide binding; protein binding; protein kinase binding; structural constituent of cytoskeleton