Recombinant Human ACTG1 protein, T7-tagged
Cat.No. : | ACTG1-162H |
Product Overview : | Recombinant human ACTG1 (357 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 357 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFGSEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNKANREKMTQIMFETFNTPAMYVA IQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR DIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKC DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ACTG1 actin, gamma 1 [ Homo sapiens ] |
Official Symbol | ACTG1 |
Synonyms | ACTG1; actin, gamma 1; ACTG, deafness, autosomal dominant 20; deafness, autosomal dominant 26 , DFNA20, DFNA26; actin, cytoplasmic 2; cytoskeletal gamma-actin; ACT; ACTG; DFNA20; DFNA26; |
Gene ID | 71 |
mRNA Refseq | NM_001199954 |
Protein Refseq | NP_001186883 |
MIM | 102560 |
UniProt ID | P63261 |
Chromosome Location | 17q25 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; |
Function | ATP binding; identical protein binding; nucleotide binding; protein binding; protein kinase binding; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
ACTG1-284M | Recombinant Mouse ACTG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTG1-025H | Recombinant Human ACTG1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Actg1-522M | Recombinant Mouse Actg1 Protein, MYC/DDK-tagged | +Inquiry |
ACTG1-819HF | Recombinant Full Length Human ACTG1 Protein, GST-tagged | +Inquiry |
ACTG1-162H | Recombinant Human ACTG1 protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTG1-9064HCL | Recombinant Human ACTG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTG1 Products
Required fields are marked with *
My Review for All ACTG1 Products
Required fields are marked with *
0
Inquiry Basket