Recombinant Human ACTN1 Protein, GST-tagged
Cat.No. : | ACTN1-229H |
Product Overview : | Human ACTN1 partial ORF ( NP_001093, 543 a.a. - 639 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.41 kDa |
AA Sequence : | EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACTN1 actinin, alpha 1 [ Homo sapiens ] |
Official Symbol | ACTN1 |
Synonyms | ACTN1; actinin, alpha 1; alpha-actinin-1; actinin 1 smooth muscle; non-muscle alpha-actinin-1; F-actin cross-linking protein; alpha-actinin cytoskeletal isoform; FLJ40884; FLJ54432; |
Gene ID | 87 |
mRNA Refseq | NM_001102 |
Protein Refseq | NP_001093 |
MIM | 102575 |
UniProt ID | P12814 |
◆ Recombinant Proteins | ||
ACTN1-229H | Recombinant Human ACTN1 Protein, GST-tagged | +Inquiry |
ACTN1-486R | Recombinant Rat ACTN1 Protein | +Inquiry |
ACTN1-45H | Recombinant Human ACTN1 protein, His-tagged | +Inquiry |
ACTN1-270H | Recombinant Human ACTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTN1-142R | Recombinant Rat ACTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTN1-9056HCL | Recombinant Human ACTN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTN1 Products
Required fields are marked with *
My Review for All ACTN1 Products
Required fields are marked with *