Recombinant Human ACTN1 Protein, GST-tagged

• Cat.No.: ACTN1-229H
• Product Overview: Human ACTN1 partial ORF ( NP_001093, 543 a.a. - 639 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.41 kDa
• AA Sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACTN1 actinin, alpha 1 [ Homo sapiens ]
• Official Symbol: ACTN1
• Synonyms: ACTN1; actinin, alpha 1; alpha-actinin-1; actinin 1 smooth muscle; non-muscle alpha-actinin-1; F-actin cross-linking protein; alpha-actinin cytoskeletal isoform; FLJ40884; FLJ54432
• Gene ID: 87
• mRNA Refseq: NM_001102
• Protein Refseq: NP_001093
• MIM: 102575
• UniProt ID: P12814