Recombinant Human ACTR1A Protein, GST-tagged
Cat.No. : | ACTR1A-232H |
Product Overview : | Human ACTR1A full-length ORF ( AAH00693, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 67.10 kDa |
AA Sequence : | MESYDVSANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACTR1A ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) [ Homo sapiens ] |
Official Symbol | ACTR1A |
Synonyms | ACTR1A; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1 (actin related protein 1, yeast) homolog A (centractin alpha); alpha-centractin; ARP1; actin-RPV; centractin; centrosome-associated actin homolog; CTRN1; FLJ52695; FLJ52800; FLJ55002; |
Gene ID | 10121 |
mRNA Refseq | NM_005736 |
Protein Refseq | NP_005727 |
MIM | 605143 |
UniProt ID | P61163 |
◆ Recombinant Proteins | ||
ACTR1A-3248H | Recombinant Human ACTR1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACTR1A-1252M | Recombinant Mouse ACTR1A Protein | +Inquiry |
Actr1a-3343R | Recombinant Rat Actr1a, His-tagged | +Inquiry |
ACTR1A-151H | Recombinant Human ACTR1A Protein, His-tagged | +Inquiry |
ACTR1A-853HF | Recombinant Full Length Human ACTR1A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTR1A-9053HCL | Recombinant Human ACTR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTR1A Products
Required fields are marked with *
My Review for All ACTR1A Products
Required fields are marked with *
0
Inquiry Basket