Recombinant Human ACTR1B Protein, GST-tagged
Cat.No. : | ACTR1B-235H |
Product Overview : | Human ACTR1B partial ORF (NP_005726.1, 191 a.a. - 285 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 191-285 a.a. |
Description : | This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 36.08 kDa |
AA Sequence : | SRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACTR1B ARP1 actin-related protein 1 homolog B, centractin beta (yeast) [ Homo sapiens ] |
Official Symbol | ACTR1B |
Synonyms | ACTR1B; ARP1 actin-related protein 1 homolog B, centractin beta (yeast); ARP1 (actin related protein 1, yeast) homolog B (centractin beta) , CTRN2; beta-centractin; centractin beta; actin-related protein 1B; PC3; ARP1B; CTRN2; |
Gene ID | 10120 |
mRNA Refseq | NM_005735 |
Protein Refseq | NP_005726 |
MIM | 605144 |
UniProt ID | P42025 |
◆ Recombinant Proteins | ||
Actr1b-1518M | Recombinant Mouse Actr1b Protein, Myc/DDK-tagged | +Inquiry |
ACTR1B-371H | Recombinant Human ACTR1B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACTR1B-26592TH | Recombinant Human ACTR1B, His-tagged | +Inquiry |
ACTR1B-227R | Recombinant Rhesus monkey ACTR1B Protein, His-tagged | +Inquiry |
ACTR1B-151H | Recombinant Human ACTR1B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTR1B-9052HCL | Recombinant Human ACTR1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTR1B Products
Required fields are marked with *
My Review for All ACTR1B Products
Required fields are marked with *