Recombinant Human ACTR3 Protein, GST-tagged
Cat.No. : | ACTR3-237H |
Product Overview : | Human ACTR3 full-length ORF ( AAH44590, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Mar 2013] |
Molecular Mass : | 71.72 kDa |
AA Sequence : | MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIAEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACTR3 ARP3 actin-related protein 3 homolog (yeast) [ Homo sapiens ] |
Official Symbol | ACTR3 |
Synonyms | ACTR3; ARP3 actin-related protein 3 homolog (yeast); ARP3 (actin related protein 3, yeast) homolog; actin-related protein 3; ARP3; actin-like protein 3; |
Gene ID | 10096 |
mRNA Refseq | NM_005721 |
Protein Refseq | NP_005712 |
MIM | 604222 |
UniProt ID | P61158 |
◆ Recombinant Proteins | ||
ACTR3-490R | Recombinant Rat ACTR3 Protein | +Inquiry |
ACTR3-4424H | Recombinant Human ACTR3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Actr3-1519M | Recombinant Mouse Actr3 Protein, Myc/DDK-tagged | +Inquiry |
ACTR3-1248HFL | Recombinant Full Length Human ACTR3 Protein, C-Flag-tagged | +Inquiry |
ACTR3-151H | Recombinant Human ACTR3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTR3-9049HCL | Recombinant Human ACTR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTR3 Products
Required fields are marked with *
My Review for All ACTR3 Products
Required fields are marked with *
0
Inquiry Basket