Recombinant Human ACVR1 Protein, GST-tagged
Cat.No. : | ACVR1-247H |
Product Overview : | Human ACVR1 full-length ORF ( AAH33867, 1 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 81.73 kDa |
AA Sequence : | MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACVR1 activin A receptor, type I [ Homo sapiens ] |
Official Symbol | ACVR1 |
Synonyms | ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI; |
Gene ID | 90 |
mRNA Refseq | NM_001105 |
Protein Refseq | NP_001096 |
MIM | 102576 |
UniProt ID | Q04771 |
◆ Recombinant Proteins | ||
ACVR1-247H | Recombinant Human ACVR1 Protein, GST-tagged | +Inquiry |
ACVR1-1022H | Recombinant Human ACVR1 Protein, MYC/DDK-tagged | +Inquiry |
ACVR1-864HF | Recombinant Full Length Human ACVR1 Protein, GST-tagged | +Inquiry |
ACVR1-245H | Active Recombinant Human ACVR1 Protein, GST-His-tagged | +Inquiry |
ACVR1-3442H | Recombinant Human ACVR1 protein, hFc-tagged, For Organoid Culture | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-967CCL | Recombinant Canine ACVR1 cell lysate | +Inquiry |
ACVR1-2686MCL | Recombinant Mouse ACVR1 cell lysate | +Inquiry |
ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-1232CCL | Recombinant Cynomolgus ACVR1 cell lysate | +Inquiry |
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR1 Products
Required fields are marked with *
My Review for All ACVR1 Products
Required fields are marked with *