Recombinant Human ACY1 Protein, GST-tagged
Cat.No. : | ACY1-262H |
Product Overview : | Human ACY1 full-length ORF ( AAH00545, 1 a.a. - 408 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 70.62 kDa |
AA Sequence : | MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACY1 aminoacylase 1 [ Homo sapiens ] |
Official Symbol | ACY1 |
Synonyms | ACY1; aminoacylase 1; aminoacylase-1; acylase; N-acyl-L-amino-acid amidohydrolase; ACY-1; ACY1D; |
Gene ID | 95 |
mRNA Refseq | NM_000666 |
Protein Refseq | NP_000657 |
MIM | 104620 |
UniProt ID | Q03154 |
◆ Recombinant Proteins | ||
ACY1-262H | Recombinant Human ACY1 Protein, GST-tagged | +Inquiry |
ACY1-327H | Recombinant Human ACY1 Protein, DDK-tagged | +Inquiry |
Acy1-424M | Recombinant Mouse Acy1 Protein, MYC/DDK-tagged | +Inquiry |
ACY1-497R | Recombinant Rat ACY1 Protein | +Inquiry |
ACY1-781H | Recombinant Human Aminoacylase 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACY1-725HCL | Recombinant Human ACY1 cell lysate | +Inquiry |
ACY1-3095MCL | Recombinant Mouse ACY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACY1 Products
Required fields are marked with *
My Review for All ACY1 Products
Required fields are marked with *
0
Inquiry Basket