Recombinant Human ACY1 protein, T7-tagged
| Cat.No. : | ACY1-165H |
| Product Overview : | Recombinant human Aminoacylase-1 (408 aa, Isoform_a) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 408 a.a. |
| Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGEFMTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVV TVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRF MEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKA FEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPAL GFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | ACY1 aminoacylase 1 [ Homo sapiens ] |
| Official Symbol | ACY1 |
| Synonyms | ACY1; aminoacylase 1; aminoacylase-1; acylase; N-acyl-L-amino-acid amidohydrolase; ACY-1; ACY1D; |
| Gene ID | 95 |
| mRNA Refseq | NM_000666 |
| Protein Refseq | NP_000657 |
| MIM | 104620 |
| UniProt ID | Q03154 |
| Chromosome Location | 3p21.2 |
| Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Urea cycle and metabolism of amino groups, organism-specific biosystem; |
| Function | aminoacylase activity; hydrolase activity; metal ion binding; metallopeptidase activity; |
| ◆ Recombinant Proteins | ||
| ACY1-1152H | Recombinant Human ACY1 Protein, DDK-tagged | +Inquiry |
| Acy1-1128M | Recombinant Mouse Acy1, His tagged | +Inquiry |
| ACY1-27198TH | Recombinant Human ACY1, His-tagged | +Inquiry |
| ACY1-4770H | Recombinant Human ACY1 protein, GST-tagged | +Inquiry |
| ACY1-262H | Recombinant Human ACY1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACY1-725HCL | Recombinant Human ACY1 cell lysate | +Inquiry |
| ACY1-3095MCL | Recombinant Mouse ACY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACY1 Products
Required fields are marked with *
My Review for All ACY1 Products
Required fields are marked with *
