"ACY1" Related Products

Expand
Expand
Expand

Recombinant Human ACY1 protein, T7-tagged

Cat.No.: ACY1-165H
Product Overview: Recombinant human Aminoacylase-1 (408 aa, Isoform_a) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVV TVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRF MEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKA FEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPAL GFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Purity: >90% by SDS-PAGE
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: ACY1 aminoacylase 1 [ Homo sapiens ]
Official Symbol: ACY1
Synonyms: ACY1; aminoacylase 1; aminoacylase-1; acylase; N-acyl-L-amino-acid amidohydrolase; ACY-1; ACY1D;
Gene ID: 95
mRNA Refseq: NM_000666
Protein Refseq: NP_000657
MIM: 104620
UniProt ID: Q03154
Chromosome Location: 3p21.2
Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Urea cycle and metabolism of amino groups, organism-specific biosystem;
Function: aminoacylase activity; hydrolase activity; metal ion binding; metallopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.