Recombinant Human ACY1 protein, T7-tagged
Cat.No. : | ACY1-165H |
Product Overview : | Recombinant human Aminoacylase-1 (408 aa, Isoform_a) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 408 a.a. |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVV TVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRF MEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKA FEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPAL GFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | ACY1 aminoacylase 1 [ Homo sapiens ] |
Official Symbol | ACY1 |
Synonyms | ACY1; aminoacylase 1; aminoacylase-1; acylase; N-acyl-L-amino-acid amidohydrolase; ACY-1; ACY1D; |
Gene ID | 95 |
mRNA Refseq | NM_000666 |
Protein Refseq | NP_000657 |
MIM | 104620 |
UniProt ID | Q03154 |
Chromosome Location | 3p21.2 |
Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Urea cycle and metabolism of amino groups, organism-specific biosystem; |
Function | aminoacylase activity; hydrolase activity; metal ion binding; metallopeptidase activity; |
◆ Recombinant Proteins | ||
ACY1-497R | Recombinant Rat ACY1 Protein | +Inquiry |
ACY1-27198TH | Recombinant Human ACY1, His-tagged | +Inquiry |
ACY1-327H | Recombinant Human ACY1 Protein, DDK-tagged | +Inquiry |
ACY1-781H | Recombinant Human Aminoacylase 1, His-tagged | +Inquiry |
ACY1-487H | Recombinant Human ACY1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACY1-3095MCL | Recombinant Mouse ACY1 cell lysate | +Inquiry |
ACY1-725HCL | Recombinant Human ACY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACY1 Products
Required fields are marked with *
My Review for All ACY1 Products
Required fields are marked with *
0
Inquiry Basket