Recombinant Human ACYP1 protein, GST-tagged
Cat.No. : | ACYP1-9362H |
Product Overview : | Recombinant Human ACYP1 protein(1-99 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | August 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-99 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK |
Gene Name | ACYP1 acylphosphatase 1, erythrocyte (common) type [ Homo sapiens ] |
Official Symbol | ACYP1 |
Synonyms | ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1; acylphosphate phosphohydrolase 1; acylphosphatase, erythrocyte isozyme; acylphosphatase, organ-common type isozyme; ACYPE; |
Gene ID | 97 |
mRNA Refseq | NM_001107 |
Protein Refseq | NP_001098 |
MIM | 600875 |
UniProt ID | P07311 |
◆ Recombinant Proteins | ||
ACYP1-16H | Recombinant Human ACYP1 protein | +Inquiry |
ACYP1-9362H | Recombinant Human ACYP1 protein, GST-tagged | +Inquiry |
ACYP1-4037C | Recombinant Chicken ACYP1 | +Inquiry |
Acyp1-3145M | Recombinant Mouse Acyp1, GST-tagged | +Inquiry |
ACYP1-1801H | Recombinant Human ACYP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACYP1-9042HCL | Recombinant Human ACYP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACYP1 Products
Required fields are marked with *
My Review for All ACYP1 Products
Required fields are marked with *