Recombinant Human ACYP1 protein, GST-tagged
| Cat.No. : | ACYP1-9362H |
| Product Overview : | Recombinant Human ACYP1 protein(1-99 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-99 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK |
| Gene Name | ACYP1 acylphosphatase 1, erythrocyte (common) type [ Homo sapiens ] |
| Official Symbol | ACYP1 |
| Synonyms | ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1; acylphosphate phosphohydrolase 1; acylphosphatase, erythrocyte isozyme; acylphosphatase, organ-common type isozyme; ACYPE; |
| Gene ID | 97 |
| mRNA Refseq | NM_001107 |
| Protein Refseq | NP_001098 |
| MIM | 600875 |
| UniProt ID | P07311 |
| ◆ Recombinant Proteins | ||
| Acyp1-1525M | Recombinant Mouse Acyp1 Protein, Myc/DDK-tagged | +Inquiry |
| ACYP1-0489H | Recombinant Human ACYP1 Protein (Met1-Lys99), N-GST-tagged | +Inquiry |
| Acyp1-3145M | Recombinant Mouse Acyp1, GST-tagged | +Inquiry |
| ACYP1-3355H | Recombinant Human ACYP1 protein, His-tagged | +Inquiry |
| ACYP1-264H | Recombinant Human ACYP1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACYP1-9042HCL | Recombinant Human ACYP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACYP1 Products
Required fields are marked with *
My Review for All ACYP1 Products
Required fields are marked with *
