Recombinant Human ADA2 Protein, GST-Tagged

Cat.No. : ADA2-1106H
Product Overview : Human ADA2 full-length ORF (NP_803124.1, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Molecular Mass : 57.1 kDa
AA Sequence : MDSLEWNWALVYELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADA2 adenosine deaminase 2 [ Homo sapiens (human) ]
Official Symbol ADA2
Synonyms ADA2; adenosine deaminase 2; CECR1; cat eye syndrome chromosome region, candidate 1; IDGFL; adenosine deaminase CECR1; ADGF; adenosine deaminase 2; cat eye syndrome critical region protein 1; ADA2;
Gene ID 51816
mRNA Refseq NM_017424
Protein Refseq NP_059120
MIM 607575
UniProt ID Q9NZK5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADA2 Products

Required fields are marked with *

My Review for All ADA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon