Recombinant Human ADA2 Protein, GST-Tagged
Cat.No. : | ADA2-1106H |
Product Overview : | Human ADA2 full-length ORF (NP_803124.1, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 57.1 kDa |
AA Sequence : | MDSLEWNWALVYELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADA2 adenosine deaminase 2 [ Homo sapiens (human) ] |
Official Symbol | ADA2 |
Synonyms | ADA2; adenosine deaminase 2; CECR1; cat eye syndrome chromosome region, candidate 1; IDGFL; adenosine deaminase CECR1; ADGF; adenosine deaminase 2; cat eye syndrome critical region protein 1; ADA2; |
Gene ID | 51816 |
mRNA Refseq | NM_017424 |
Protein Refseq | NP_059120 |
MIM | 607575 |
UniProt ID | Q9NZK5 |
◆ Recombinant Proteins | ||
ADA2-278H | Recombinant Human ADA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADA2-0026H | Recombinant Human ADA2 Protein (Ile30-Lys511), N-His-tagged | +Inquiry |
ADA2-281H | Active Recombinant Human ADA2 Protein, His-tagged | +Inquiry |
ADA2-163HFL | Recombinant Full Length Human ADA2 Protein, C-Flag-tagged | +Inquiry |
ADA2-1830H | Recombinant Human ADA2 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADA2 Products
Required fields are marked with *
My Review for All ADA2 Products
Required fields are marked with *