Recombinant Human ADAD1 protein, His-tagged
Cat.No. : | ADAD1-9366H |
Product Overview : | Recombinant Human ADAD1 protein(1 - 260 aa), fused with His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 260 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLSSISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYKTGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVHYEGRHIQYAKISQIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYSQD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | ADAD1 adenosine deaminase domain containing 1 (testis-specific) [ Homo sapiens ] |
Official Symbol | ADAD1 |
Synonyms | ADAD1; adenosine deaminase domain containing 1 (testis-specific); adenosine deaminase domain-containing protein 1; Tenr; testis nuclear RNA-binding protein; FLJ32741; |
Gene ID | 132612 |
mRNA Refseq | NM_001159285 |
Protein Refseq | NP_001152757 |
MIM | 614130 |
UniProt ID | Q96M93 |
◆ Recombinant Proteins | ||
ADAD1-8426Z | Recombinant Zebrafish ADAD1 | +Inquiry |
ADAD1-1272M | Recombinant Mouse ADAD1 Protein | +Inquiry |
Adad1-1527M | Recombinant Mouse Adad1 Protein, Myc/DDK-tagged | +Inquiry |
ADAD1-841HF | Recombinant Full Length Human ADAD1 Protein, GST-tagged | +Inquiry |
ADAD1-9365H | Recombinant Human ADAD1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAD1-9040HCL | Recombinant Human ADAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAD1 Products
Required fields are marked with *
My Review for All ADAD1 Products
Required fields are marked with *
0
Inquiry Basket