Recombinant Human ADAD1 protein, His-tagged
| Cat.No. : | ADAD1-9366H |
| Product Overview : | Recombinant Human ADAD1 protein(1 - 260 aa), fused with His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1 - 260 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLSSISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYKTGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVHYEGRHIQYAKISQIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYSQD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | ADAD1 adenosine deaminase domain containing 1 (testis-specific) [ Homo sapiens ] |
| Official Symbol | ADAD1 |
| Synonyms | ADAD1; adenosine deaminase domain containing 1 (testis-specific); adenosine deaminase domain-containing protein 1; Tenr; testis nuclear RNA-binding protein; FLJ32741; |
| Gene ID | 132612 |
| mRNA Refseq | NM_001159285 |
| Protein Refseq | NP_001152757 |
| MIM | 614130 |
| UniProt ID | Q96M93 |
| ◆ Recombinant Proteins | ||
| ADAD1-9365H | Recombinant Human ADAD1, His-tagged | +Inquiry |
| ADAD1-269H | Recombinant Human ADAD1 Protein, GST-tagged | +Inquiry |
| ADAD1-841HF | Recombinant Full Length Human ADAD1 Protein, GST-tagged | +Inquiry |
| ADAD1-156R | Recombinant Rat ADAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADAD1-304M | Recombinant Mouse ADAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAD1-9040HCL | Recombinant Human ADAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAD1 Products
Required fields are marked with *
My Review for All ADAD1 Products
Required fields are marked with *



