Recombinant Human ADAL protein, GST-tagged
Cat.No. : | ADAL-7211H |
Product Overview : | Recombinant Human ADAL protein(31-200 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 31-200 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | ISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMFQTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKK |
Gene Name | ADAL adenosine deaminase-like [ Homo sapiens ] |
Official Symbol | ADAL |
Synonyms | ADAL; adenosine deaminase-like; adenosine deaminase-like protein; FLJ44620; DKFZp313B2137; |
Gene ID | 161823 |
mRNA Refseq | NM_001012969 |
Protein Refseq | NP_001012987 |
UniProt ID | Q6DHV7 |
◆ Recombinant Proteins | ||
ADAL-3419Z | Recombinant Zebrafish ADAL | +Inquiry |
ADAL-1274M | Recombinant Mouse ADAL Protein | +Inquiry |
ADAL-2261C | Recombinant Chicken ADAL | +Inquiry |
ADAL-271H | Recombinant Human ADAL Protein, GST-tagged | +Inquiry |
ADAL-143H | Recombinant Human ADAL, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAL-9039HCL | Recombinant Human ADAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAL Products
Required fields are marked with *
My Review for All ADAL Products
Required fields are marked with *