Recombinant Human ADAM10 Protein, GST-tagged

• Cat.No.: ADAM10-272H
• Product Overview: Human ADAM10 partial ORF ( NP_001101, 346 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 346-435 aa
• Description: Members of the ADAM family are cell surface proteins with a unique structure possessing both potential adhesion and protease domains. This gene encodes and ADAM family member that cleaves many proteins including TNF-alpha and E-cadherin. Alternate splicing results in multiple transcript variants encoding different proteins that may undergo similar processing. [provided by RefSeq, Feb 2016]
• Molecular Mass: 35.64 kDa
• AA Sequence: KSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAM10 ADAM metallopeptidase domain 10 [ Homo sapiens ]
• Official Symbol: ADAM10
• Synonyms: ADAM10; ADAM metallopeptidase domain 10; a disintegrin and metalloproteinase domain 10; disintegrin and metalloproteinase domain-containing protein 10; CD156c; HsT18717; kuz; MADM; CDw156; ADAM 10; kuzbanian protein homolog; mammalian disintegrin-metalloprotease; a disintegrin and metalloprotease domain 10; AD10
• Gene ID: 102
• mRNA Refseq: NM_001110
• Protein Refseq: NP_001101
• MIM: 602192
• UniProt ID: O14672