Recombinant Human ADAM10 Protein, GST-tagged
Cat.No. : | ADAM10-272H |
Product Overview : | Human ADAM10 partial ORF ( NP_001101, 346 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the ADAM family are cell surface proteins with a unique structure possessing both potential adhesion and protease domains. This gene encodes and ADAM family member that cleaves many proteins including TNF-alpha and E-cadherin. Alternate splicing results in multiple transcript variants encoding different proteins that may undergo similar processing. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | KSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAM10 ADAM metallopeptidase domain 10 [ Homo sapiens ] |
Official Symbol | ADAM10 |
Synonyms | ADAM10; ADAM metallopeptidase domain 10; a disintegrin and metalloproteinase domain 10; disintegrin and metalloproteinase domain-containing protein 10; CD156c; HsT18717; kuz; MADM; CDw156; ADAM 10; kuzbanian protein homolog; mammalian disintegrin-metalloprotease; a disintegrin and metalloprotease domain 10; AD10; |
Gene ID | 102 |
mRNA Refseq | NM_001110 |
Protein Refseq | NP_001101 |
MIM | 602192 |
UniProt ID | O14672 |
◆ Recombinant Proteins | ||
ADAM10-1275M | Recombinant Mouse ADAM10 Protein | +Inquiry |
ADAM10-7638H | Recombinant Human ADAM10 protein, His-tagged | +Inquiry |
ADAM10-0691H | Recombinant Human ADAM10 Protein (Thr214-Ser504), N-His tagged | +Inquiry |
ADAM10-265H | Recombinant Human ADAM 10, His-tagged | +Inquiry |
ADAM10-924H | Active Recombinant Human ADAM10 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ADAM10-13H | Active Recombinant Human ADAM10 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM10 Products
Required fields are marked with *
My Review for All ADAM10 Products
Required fields are marked with *
0
Inquiry Basket