Recombinant Human ADAM15 Protein, GST-tagged
| Cat.No. : | ADAM15-277H |
| Product Overview : | Human ADAM15 partial ORF ( AAH14566, 301 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | AQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAM15 ADAM metallopeptidase domain 15 [ Homo sapiens ] |
| Official Symbol | ADAM15 |
| Synonyms | ADAM15; ADAM metallopeptidase domain 15; a disintegrin and metalloproteinase domain 15 (metargidin); disintegrin and metalloproteinase domain-containing protein 15; MDC15; metargidin; MDC-15; ADAM 15; metalloprotease RGD disintegrin protein; metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15; |
| Gene ID | 8751 |
| mRNA Refseq | NM_003815 |
| Protein Refseq | NP_003806 |
| MIM | 605548 |
| UniProt ID | Q13444 |
| ◆ Recombinant Proteins | ||
| ADAM15-277H | Recombinant Human ADAM15 Protein, GST-tagged | +Inquiry |
| RFL-8603MF | Recombinant Full Length Mouse Disintegrin And Metalloproteinase Domain-Containing Protein 15(Adam15) Protein, His-Tagged | +Inquiry |
| ADAM15-948M | Active Recombinant Mouse ADAM15 Protein, His-tagged | +Inquiry |
| ADAM15-863HF | Recombinant Full Length Human ADAM15 Protein, GST-tagged | +Inquiry |
| ADAM15-2422H | Recombinant Human ADAM15 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAM15-1820MCL | Recombinant Mouse ADAM15 cell lysate | +Inquiry |
| ADAM15-001HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
| ADAM15-2808HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM15 Products
Required fields are marked with *
My Review for All ADAM15 Products
Required fields are marked with *
