Recombinant Human ADAM20 protein, GST-tagged
Cat.No. : | ADAM20-2722H |
Product Overview : | Recombinant Human ADAM20 protein(492-693 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 492-693 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | HPGAACAFGICCKDCKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISCNVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGTTYVKCWTPDIMCGRVQCENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHLSQACQPKTCNMR |
Gene Name | ADAM20 ADAM metallopeptidase domain 20 [ Homo sapiens ] |
Official Symbol | ADAM20 |
Synonyms | ADAM20; ADAM metallopeptidase domain 20; a disintegrin and metalloproteinase domain 20; disintegrin and metalloproteinase domain-containing protein 20; ADAM 20; |
Gene ID | 8748 |
mRNA Refseq | NM_003814 |
Protein Refseq | NP_003805 |
MIM | 603712 |
UniProt ID | O43506 |
◆ Recombinant Proteins | ||
ADAM20-2722H | Recombinant Human ADAM20 protein, GST-tagged | +Inquiry |
ADAM20-7100C | Recombinant Chicken ADAM20 | +Inquiry |
ADAM20-3001H | Recombinant Human ADAM20, His-tagged | +Inquiry |
ADAM20-0247H | Recombinant Human ADAM20 Protein (His367-Gly615), N-His-tagged | +Inquiry |
ADAM20-281H | Recombinant Human ADAM20 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM20 Products
Required fields are marked with *
My Review for All ADAM20 Products
Required fields are marked with *