Recombinant Human ADAM29 Protein, GST-tagged

Cat.No. : ADAM29-285H
Product Overview : Human ADAM29 partial ORF ( NP_055084, 339 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Jul 2008]
Molecular Mass : 32.34 kDa
AA Sequence : GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAM29 ADAM metallopeptidase domain 29 [ Homo sapiens ]
Official Symbol ADAM29
Synonyms ADAM29; ADAM metallopeptidase domain 29; a disintegrin and metalloproteinase domain 29; disintegrin and metalloproteinase domain-containing protein 29; cancer/testis antigen 73; CT73; svph1;
Gene ID 11086
mRNA Refseq NM_001130703
Protein Refseq NP_001124175
MIM 604778
UniProt ID Q9UKF5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAM29 Products

Required fields are marked with *

My Review for All ADAM29 Products

Required fields are marked with *

0
cart-icon