Recombinant Human ADAM29 Protein, GST-tagged
| Cat.No. : | ADAM29-285H |
| Product Overview : | Human ADAM29 partial ORF ( NP_055084, 339 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 32.34 kDa |
| AA Sequence : | GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAM29 ADAM metallopeptidase domain 29 [ Homo sapiens ] |
| Official Symbol | ADAM29 |
| Synonyms | ADAM29; ADAM metallopeptidase domain 29; a disintegrin and metalloproteinase domain 29; disintegrin and metalloproteinase domain-containing protein 29; cancer/testis antigen 73; CT73; svph1; |
| Gene ID | 11086 |
| mRNA Refseq | NM_001130703 |
| Protein Refseq | NP_001124175 |
| MIM | 604778 |
| UniProt ID | Q9UKF5 |
| ◆ Recombinant Proteins | ||
| ADAM29-285H | Recombinant Human ADAM29 Protein, GST-tagged | +Inquiry |
| ADAM29-284H | Recombinant Human ADAM29 Protein | +Inquiry |
| ADAM29-0461H | Recombinant Human ADAM29 Protein (Asn253-Arg670), N-His-tagged | +Inquiry |
| ADAM29-884HF | Recombinant Full Length Human ADAM29 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM29 Products
Required fields are marked with *
My Review for All ADAM29 Products
Required fields are marked with *
